Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:GRMZM2G056569-GRMZM2G095593
Species:maize
Duplication type:WGD
Function (paralog1):Putative uncharacterized protein
Function (paralog2):Putative uncharacterized protein

Regulation information
Data set:seedling_Lei_2015
Log2 RF fold difference:-1.0118438241518
Log2 mRNA fold difference:0.51937954739359
Log2 TE fold difference:-1.5263136025957
Sequences
Protein sequence

MGQGTPGGMGKQGGAGDRKPGDAGDKKDKKFEPPAAPSRVGRKQRKQKGAEAAARLPNVA
PLSKCRLRLLKLDRVKDYLLMEEEFVAAQERLRPQEDKAEEDRSKVDDLRGTPMSVGSLE
EIIDESHAIVSSSVGPEYYVGILSFVDKDQLEPGCSILMHNKVLSVVGILQDEVDPMVSV
MKVEKAPLESYADIGGLDAQIQEIKEAVELPLTHPELYEDIGIRPPKGVILYGEPGTGKT
LLAKAVANSTSATFLRVVGSELIQKYLGDGPKLVRELFRVADELSPSIVFIDEIDAVGTK
RYDAHSGGEREIQRTMLELLNQLDGFDSRGDVKVILATNRIESLDPALLRPGRIDRKIEF
PLPDIKTRRRIFQIHTSKMTLADDVNLEEFVMTKDEFSGADIKAICTEAGLLALRERRMK
VTHADFKKAKEKVMYKKKEGVPDGLYM*

MHNKVLSVVGILQDEVDPMVSVMKVEKAPLESYADIGGLDSQIQEIKEAVELPLTHPELY
EDIGIRPPKGVILYGEPGTGKTLLAKAVANSTSATFLRVVGSELIQKYLGDGPKLVRELF
RVADELSPSIVFIDEIDAVGTKRYDAHSGGEREIQRTMLELLNQLDGFDSRGDVKVILAT
NRIESLDPALLRPGRIDRKIEFPLPDIKTRRRIFQIHTSKMTLADDVNLEEFVMTKDEFS
GADIKAICTEAGLLALRERRMKVTHADFKKAKEKVMYKKKEGVPDGLYM*

Other information
Ka divergence:1KaKs divergence:0.984848
GC content 1 (%):52GC content 2 (%):43GC content divergence:-0.095
Length 1 (bp):1344Length 2 (bp):870Length divergence:-0.214
MFE 1 (kcal):-473.08MFE 2 (kcal):-247.64MFE divergence-0.313