Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:GRMZM2G056600-GRMZM2G041127
Species:maize
Duplication type:WGD
Function (paralog1):hypothetical protein LOC100272620
Function (paralog2):hypothetical protein LOC100194336

Regulation information
Data set:seedling-drought_Lei_2015
Log2 RF fold difference:0
Log2 mRNA fold difference:0
Log2 TE fold difference:0
Sequences
Protein sequence

MKRPRGASPPLAAMTNPNDDGYGVVGMEADADADADEEMMACGGGGEKKRRLSSEQVRAL
ERSFEVENKLEPERKARLARDLGLQPRQVAVWFQNRRARWKTKQLERDYSALRQSYDALR
HDHDALRRDKDALLAEIKELKAKLGDEEAAASFTSVKAEPAASDGPPPVGVGSSESDSSA
VLNDADPPVAEAPVPEVRGTLLDAPGAVAANHGGVFFHGSFLKVEEDETGLLDDDEPCGG
FFSVEQPPPMAWWTEPTEHWN*

MSWRECVRNEDLSPCACVFPDDGYGVLGMEADVDVDVDEEMMAFGGGGGGEKKRRLSAEQ
VRALERSFEVENKLEPERKARLARDLGLQPRQVAVWFQNRRARWKTKQLERDYAALRRSY
DALRLDHDALRRDKDALLAEIRELKAKLGDDEDAAASFTSVKAEPAASDGPAPAGVGSSE
ISDSSAVLNDADPPVAEAPAPAPEVQGTLLVAPAGPVAGAAAANHGGVFFHGSFLKVEED
ETGLLDDDGPCGGFFAVEQPPAMAWWNEPAEHWN*

www.000webhost.com

Other information
Ka divergence:0KaKs divergence:0
GC content 1 (%):70GC content 2 (%):71GC content divergence:0.007
Length 1 (bp):786Length 2 (bp):825Length divergence:0.024
MFE 1 (kcal):-409.92MFE 2 (kcal):-433MFE divergence0.027