Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:GRMZM2G056762-GRMZM2G026922
Species:maize
Duplication type:WGD
Function (paralog1):hypothetical protein LOC100276928
Function (paralog2):

Regulation information
Data set:seedling-drought_Lei_2015
Log2 RF fold difference:0
Log2 mRNA fold difference:0
Log2 TE fold difference:0
Sequences
Protein sequence

MRNPPGRHLLCLSSRAVRSSSSSSALGPGPGAVTSAASPRPRAIAPGRPLRASSPSPPYA
VAAAAYVEDGDWEEVVAGGPGTGEMEEEQDYRVVFWSPPTIDEVTGAVTSIQQVFENPLG
LDSDTTDRQTTLLSASGHSSGNSSGSDDWIEPAAYVLNSTALLSREHRNVVDAFRLLQKD
PTVQKMVMSLSCDKAVWNAVMNNEAVQDFRRSLHDGKENDRNENTGGPAEVLKWILESAQ
AKIVEFLENVQKIINMLIHTPEDDDNPDGYSDAVKVSFMLTVFVFIVVAIARINYEHWDY
KVW*

MRNPPGRHLLRLTNRAVRSSSSSSSAPGAGPGASTSAASPRPRAIADGRPLRASSPPPPS
AVAAAAAAYWESRALRRDGEEGDWEEVVAGVPGTGEMEEGEEYRVVFWCPPTIDEVTGAV
TSIQEVFENPLGLDSDTTDRQTALLSASGHSSGNSSGSDDWIEPAAYVLNSTALLSREHR
SVLDAFRLLQKDPTVQKMVMSLSCDKAVWDAVMNNEAVQDFRRPLHDGKESDRKGNTGGP
AEVLKWVLESAQAKIIEFIENAMKIINMLIHPEEDEDKPDAYSDAVKVSFMLTIFVFIVV
DIARTNYERWDNKVW*

Other information
Ka divergence:0KaKs divergence:0
GC content 1 (%):53GC content 2 (%):55GC content divergence:0.019
Length 1 (bp):912Length 2 (bp):948Length divergence:0.019
MFE 1 (kcal):-343.6MFE 2 (kcal):-377.17MFE divergence0.047