Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:GRMZM2G056849-GRMZM2G136311
Species:maize
Duplication type:WGD
Function (paralog1):
Function (paralog2):hypothetical protein LOC100278488

Regulation information
Data set:seedling_Lei_2015
Log2 RF fold difference:0.26443800590585
Log2 mRNA fold difference:0.13558926599445
Log2 TE fold difference:0.087197054602353
Sequences
Protein sequence

MDKGKSVVAELAASFSDVRVTPRQNPKTKSFLPSPSFYSSSKKGKPQKLVSLCLGTLGQH
LEDIITDISEFAALFPPHIKLTIMSIARRRRLLNDEVLTSLAESSWEILDISGSDVTDAG
LATVANVCSNLRAVDISRCEKVTTSGVSEIVCHCPSLEILRCGGCPRSEVTARRCLDLLK
PKLNNLEEDSWEELNTLDIGGGAESLKWLVWVCKQVHFSSYDLWCVYNSPIRISCLMNIF
PVLQPKIDDNSKETLAAECPRVTVNPQPSLFDLSGSKVPVEALASVPLDHSIVEDIDPKT
WAVSAAPRRPVAPPNPNAPPEIPIAERFRLAYVEREARLAPKRAKRERQQRRRAERDYMM
NDIDARSMALAAQASRNLRKS*

MDKGKSVVAELSASSSSLPSPSSYPFSKKAKPRKLVSLCLGTLGQHLEDIITDISEFAAL
FPPHITLAIMSIARRKSLLNDKVLTSLAESSWQILDISGSDVTDAGLATVANVCSNLRAV
DISRCEKITTAGVSEIVCHCPSLEILRCGGCPRSEVTARRCLNLLKPKLNALEEDSWEEL
DTLDIGGGAESLRWLVWPMIDDKSKVTLAVECPRVTVNPQPSLFDLSGYSKVPIEALSSV
PLDHSVVEDIDPKTWAVSAAPPRAVAPANPNVPSAPPEIPMAERFRLAYVEREARLAPKR
AKRERQRRRRAERDYMMVDIDARSVALAAQASRNLRKS*

Other information
Ka divergence:0.381301KaKs divergence:0.514622
GC content 1 (%):47GC content 2 (%):49GC content divergence:0.021
Length 1 (bp):1146Length 2 (bp):1017Length divergence:-0.06
MFE 1 (kcal):-371.29MFE 2 (kcal):-336MFE divergence-0.05