Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:GRMZM2G056870-AC149475.2
Species:maize
Duplication type:WGD
Function (paralog1):proteasome subunit alpha type 5
Function (paralog2):

Regulation information
Data set:seedling-drought_Lei_2015
Log2 RF fold difference:0
Log2 mRNA fold difference:0
Log2 TE fold difference:0
Sequences
Protein sequence

MFLTRTEYDRGVNTFSPEGRLFQVEYAIEAIKLGSTAIGLKTKDGVVLAVEKRVTSPLLE
PSSVEKIMEIDEHIGCAMSGLIADARTLVEHARVETQNHRFSYGEPMTVESSTQAICDLA
LRFGEGDEESMSRPFGVSLLIAGHDENGPSLYYTDPSGTFWQCNAKAIGSGSEGADSSLQ
EQYNKELTLQEAETIALSILKQVMEEKVTPNNVDIAKVAPKYHLYTPAEVEAVIARL*

MSPPPAVATGGSGEPTVPAWLRGLPRAPEYRPTESEFADPIAFLSRVEREAAAYGICKVI
PPYPRPSRRFVFAHLNRSLVSSSEAANPTTASGSSATAPSLPESAAVFTTRHQELGTPRR
GRPPPQVLKQVWQSGERYTLDQFEAKSRAFSKIHLAGLREPTPLEVESLFWKASADRPIY
IEYANDVPGSGFAAPKQSQRHKKRRRESDQVEEGEKGSGWRLSGSPWNLQAIARAPGSLT
RFMPDDVPGVTSPMVYIGMLFSWFAWHVEDHELHSLNFLHTGAPKTWYAVPGDRASELEE
VIRVHGYGGNPDRLGICPFSCSPSECFGCGLAGTSSEMASVSIGSNVHDIIQTSDSYEFF
ADMYCFSFIELIVMCYLLTMFIPALLDFHLHGFNCGEAANFATPQWLKFAKEAAVRRAVM
NYLPMLSHQQLLYLLAVSFITRTPNVLSGIRSRLRDRKKEERELLVKQEFLQDMISENKL
LCSFLEKKSIRHVVLWEPDLLPSSTALHSCSSGSKAPEKKSEDGCRIESSERGTKDNSSD
GSAHMIGAQTKFMSGNSKSSGTASASMDEVNADTDDEDDLPFDLSIDSGSLTCVACGILG
YPFMAILQPSREVLEGISLAHTSRYKMSSEKDNCSNTIPCCPTDRCSFVPSRPSWPAEQQ
CLATPLGQANISHQNVNSHKDVCLRENEPNGPVPQCNNISHSCRSENTLHSCSDRGKSEN
KISEDSLGPEVGEQTGKYVINAQAAESSDGTINWNTYCTFARPRIFCLQHALEIEKLLEG
KGGVHGLIICHSDFVKLKALAISVAEEIEFQFDCTDISLAKASKSDLHLINISIDDEGHE
EDGRDWTSQMGLNLKYSAKLRKEKSENQEQSPLPFGGLLSCPSPVSVVPNLKWLCKRART
PYTVIGTMRGSSATATAAELKPGVKTEIFTNGNVCEDDNRHHSFRQTGLEQPGGLQDCDK
PSCSEENGHGRHCLVNIPIAVAEYPMMHQVREGPVSVSTCNDSICLSGSLDLPPHASPVE
VTRYLGCIQSTELSSLPAFSVQHFFNDESTSVEGSIDCVSNGCLESQDDILGSRDERLQV
QQYQEKMGLRNNPNMKSVDSHLIEGLAVSEGKHGETVAAFLENKERCAKTSYCSNTETKT
TKSAIDNRLETHHLGTGPVKLNSSFNEMHSADRQCSLVFGCLDSADVPASTQALSVSPVL
MSDEQQVDDAHSAVKAIEHLGNNLANIKHKSLHMDVLMLEDAQVASMAAVPGHEGESVEA
GSNSFDILLGALAEESKAADAPGKDEVGKASLTLITLASNEPSVTEGRVVDVVETDTILG
AGKDDKQLDQPHGFHLSDLVSRCIGSSNRSDIICYVRRKHKRKRDYSCFVRSPCESLRPR
SKPAVVEESEWSRTAEASFAKRGKRTQAVGSFQCDIDLCDMAFETRAELNAHKRNICTDE
SCGKRFSSHKYLKRHQCVHSEMRPFKCPWEGCKMTFKWLWAQTEHVRVHTGERPYKCSAP
DCGQTFRYVSDYSRHRKKFNHY*

Other information
Ka divergence:0KaKs divergence:0
GC content 1 (%):50GC content 2 (%):48GC content divergence:-0.02
Length 1 (bp):714Length 2 (bp):4569Length divergence:0.73
MFE 1 (kcal):-255.7MFE 2 (kcal):-1567.18MFE divergence0.719