Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:GRMZM2G056903-GRMZM2G150714
Species:maize
Duplication type:WGD
Function (paralog1):hypothetical protein LOC100381572
Function (paralog2):hypothetical protein LOC100382097

Regulation information
Data set:seedling_Lei_2015
Log2 RF fold difference:-0.72443115828534
Log2 mRNA fold difference:-1.079157373109
Log2 TE fold difference:0.48060643108783
Sequences
Protein sequence

MEMAGAAEADTPSHEPVRTGRSNTILLPIVGVLFAYLLYRFLRPRLRRGLRLDRHVPFPS
GASLPAWLRRRAPSGSAVLPYFAPIADRLGALPYLGPFADRLPHGGGAHALVTFPGGEAL
SVATILEAPGEVVAKSAHSTLYRAAVRSGEAAVLLRFVRPACAVAAEEAYAAARRVGAVS
HPNLVPLRAVYVGPRGEKLLVHPFYAAGSLHRFLQEGIEESHRWSIVCNLSLGIAKGLDH
LHTGLDKPMVHGNLKTSNVLLDANYECRISDYGLYLLLSPAAAQEMLEASAAQGYKAPEL
VKMRDATCESDVYSLGVVLLELLAQKERADDDGRPNPRDILLPASFKNLVLERKISDAFS
SDLARHCKRSGKEKSLNAFFELATACCSPSPSLRPSTRQVLKRLEEIAR*

MEMAGAAEADTPSQEPVRTGRSNTILLPIGGILLAYLLYRFLRPRLRGLRLDLPAWLRCR
RAPTGGGAVLPYFAPIADRLGAVALPYLGAFAGPQAALLRFPGGEALSVAAILEAPGEVV
AKSAHSTLYRAAVRSGEAAVLLRFVRPACADEAFAAAAARRIGAVRHPNLVPLRAVYVGP
RGEKLLVYPFYAAGSLQRFLQEGIAESQRWSIVCKLSIGIARGLDHLHTGLDKPMVHGNL
KTSNVLLDASYDECRVSDYGLHLLLSPAAAQEALEAAAAQGYGAPELAKARDATRESDVY
SLGVVLLELLATAPAGGDGVGDGILLLPASSSSSFKNLVLERKISDAFGSSGLARQCRSG
AGKERSLGAFFELATACCSPSPSLRPSARQVLQRLQEIAR*

Other information
Ka divergence:0.454207KaKs divergence:-0.42658
GC content 1 (%):70GC content 2 (%):73GC content divergence:0.021
Length 1 (bp):1230Length 2 (bp):1203Length divergence:-0.011
MFE 1 (kcal):-609.9MFE 2 (kcal):-654.5MFE divergence0.035