Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:GRMZM2G057026-GRMZM2G142157
Species:maize
Duplication type:WGD
Function (paralog1):
Function (paralog2):Putative uncharacterized protein

Regulation information
Data set:seedling-drought_Lei_2015
Log2 RF fold difference:0
Log2 mRNA fold difference:0
Log2 TE fold difference:0
Sequences
Protein sequence

MLMVLFCCHRNLRIREDTAKYLLNLDVNSAYYDPKTRSMREDPLPDADPNDKFYVGDNQN
RLSGQALEFKQLNIHAWEAFEKGQDIHMQAAPSQAELLYKSFKVKKEMLKSEHKDKIMEK
YGNAASEDAIPRELLLGQSEREIEYDRTGRIIKGQDVSLPKSKYEEDVFINNHTSVWGSW
WKDHQWGYKCCKQTIKNSYCTGLAGIEAAEASADLMKANMARKEAAEDEPVQHEEKRLAT
WGTDVPQDLVLNEKKLQESLKKETARRKEEKDERKRKYNVKFNDEVTAEDMEAYRMKRIH
HDDPMKDFLN*

MATASVTFKSREDHRKQLELEEARKAGLAPAEVDEDGNEINPHIPQYMSSAPWYLNAEKP
SLKHQRKWKSDPNYTKSWYDRGAKLFQANKYRKGACENCGAMTHDKKSCMERPRNVGAKW
TNVNIAPDEKVESFELDYDGKRDRWNGYDASTYTRVIADYEAREEARKKYLKEQQLKKLE
EKDTEKDDENAGSEDEEDDLRIDEAKVDESAQMDFAKVEKRVRTTGGGSTGTVRNLRIRE
DTAKYLLNLDVNSAYYDPKTRSMREDPLPDADPNDKFYVVSN*

Other information
Ka divergence:0KaKs divergence:0
GC content 1 (%):44GC content 2 (%):48GC content divergence:0.043
Length 1 (bp):933Length 2 (bp):849Length divergence:-0.047
MFE 1 (kcal):-267.54MFE 2 (kcal):-254.5MFE divergence-0.025