Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:GRMZM2G057093-GRMZM2G162505
Species:maize
Duplication type:TD
Function (paralog1):
Function (paralog2):chitinase 2

Regulation information
Data set:seedling_Lei_2015
Log2 RF fold difference:0.20703622654711
Log2 mRNA fold difference:0.26208511200211
Log2 TE fold difference:-0.088500149799395
Sequences
Protein sequence

MCTSKSKLIAAVLLAAAALPLHAPTTMAANSNLFRDYIGAIFNGVQFSDVPINPDVEFDY
ILAFVIDYSTETDPPSPTNGQFSIFWQDSVLTPSAVAAIKQSNPNVRVAVSLGGATVNNS
PVFFNVTSIDSWVQNAVSSLTTIIQQYNLDGIDIDYEQFQEDPATFAECIGRLVTTLKSN
GVIKFASVAPFADADVQSHYQALWSSYGISVVDYINFQFYAYDASTTAEQYVNYFDEQMA
NYPGGNILASFTTAPTTTSVPVDTALSACQTLQSQGKLYGIFVWAADYSKDQGFKYETQA
QALLANST*

MGYSKRIALVLVAAVVALHVHVPMATAANSNLFRDYIGAIFNGVKFTDVPINPRVRFDYI
LAFVIDYTTATEPPTPTNGQFNIFWQDSVLTASAVAAIKQSNPNVRVAVSIGGATVNDRP
VFFNITSVDSWVQNAVSSLTTIIQKYNLDGIDIDYEQFQADPATFAECIGRLVTTLKSNG
VISFASIAPFDNADVQRHYQALWATYGSVIDYVNFQFYAYGASTTEAQYVDFFNQQLVNY
PGGNILASFTTAPTTTSVPINTSLSACQTLQSQGKLYGIFIWAADHSRSQGFKYDTQAQA
LLANAPAGY*

Other information
Ka divergence:-0.298436KaKs divergence:-0.57094
GC content 1 (%):61GC content 2 (%):62GC content divergence:0.008
Length 1 (bp):927Length 2 (bp):930Length divergence:0.002
MFE 1 (kcal):-338.42MFE 2 (kcal):-338.1MFE divergence0