Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:GRMZM2G057158-GRMZM2G127101
Species:maize
Duplication type:WGD
Function (paralog1):hypothetical protein LOC100383383
Function (paralog2):LOC100283983

Regulation information
Data set:seedling_Lei_2015
Log2 RF fold difference:0.049122452076862
Log2 mRNA fold difference:0.57518281577217
Log2 TE fold difference:-0.53191679499075
Sequences
Protein sequence

MGGGDADAGGEPAAAQATLHIRCTNGSKFAVRADLGATVGTFKAIVADSCDVPAPQQRLI
YKGRILKDEQTLASYGVETDHTIHMVRGAAPPPASTAPAANQEPTTAAPASSPAAGLGGL
LQNLGATGAAANSGGLGLFGSGLPELDHMQQQLAENPNLMREIMNMPLMQNLMNSPELIR
SIIMNNPQMRELIDRNPDLAHVLNDPSIMRQTFEAVRNPELMREMMRNTDRAMSNIESSP
EGFNMLRRMYETVQEPFLNATTMGSEGDRNSNPFAALLGNQGSNQARDSAANGTTTASDT
TSGAPAPNTNPLPNPWGPNAGSAQGAARSPPATNTRSTTAGGPGGLGSADFGSTLGASGG
GSDATFLTQVLQNPTMMQMMQNIMSNPQSMNQLLNMNPNVRNMMESNTQMREMIQNPEFI
RQLTSPETLQQLISFQQSLMSQLGQQQTGQERTQSASGAGNVNLNTLMNMFSGLGAGGGL
GVPNAPNVPPEELYATQLAQLQEMGFFDTQENIRALAATAGNVHAAVERLLGNMGQ*

MGGGDADAGGEPADAQATLHIRCTNGSKFTVRTDLGATVGAFKAIVAHSCDVPAPQQRLI
YKGRILKDEQTLASYGVETDHTIHMVRGAVLSPTSTAPAANQEPTTAAPASSPATGLGGL
LQSLGTTGAAANSEGLFGSAPPGLDQMQQQLAENPNLMREMMNMPLMQNLMNNPELIRSI
IMNNPQMRELIDRNPDLAHVLNDPSIMRQTFEAVRNPELMREMMRNTDRAMSNIESSPEG
FNMLRRMYETVQEPFLNATTMGSEGDRNSNPFSALLGNQGSNQARDSAANGTTRASDPTS
GSPAPNTNPLPNPWGSNAGSAQGAARSSPASNVRSTTASGLGGLGSADLGSTHGASGGGS
DATLLTQVLQNPTMMQMMQNIMSNPQSMNQLLNMNPNVRNMMESNTQMREMIENPEFLRQ
LTSPETLQQLISFQQSLMSQLGQQQAGQERTQSGSGAGNVNLNTLMNMFSGLGAGGGLGV
PNAPNAPPEELYATQLAQLQEMGFFDTQENIRALAATAGNVHAAVERLLGNMG*

Other information
Ka divergence:0.346768KaKs divergence:0.259703
GC content 1 (%):50GC content 2 (%):51GC content divergence:0.01
Length 1 (bp):1611Length 2 (bp):1602Length divergence:-0.003
MFE 1 (kcal):-570.34MFE 2 (kcal):-556.8MFE divergence-0.012