Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:GRMZM2G057184-GRMZM2G020409
Species:maize
Duplication type:WGD
Function (paralog1):hypothetical protein LOC100279521 (LOC100279521), mRNA
Function (paralog2):

Regulation information
Data set:seedling-drought_Lei_2015
Log2 RF fold difference:0
Log2 mRNA fold difference:0
Log2 TE fold difference:0
Sequences
Protein sequence

MDKIQSDCPYPGCFFCVMKEANPSKRRASVLKFFRELPSQDDDGQVLPVSGLWNTAMAHP
NDPEFINLGIFECMAALIWKGLKNRRWLAHDQNIYVPYYAAHIIGSYTMNMEEFAECAVR
AGVIPPLVELLRGRLTWVEQRVAVRALGHLATYPSTFPAVADNGEVLELATQLASSSLEI
VYTHFYQFVDRRLDYHCGLLTRGMGGVEMESRKAEEWASQLQCWSLQLINCFAFKPEFLH
DICKPDFLVKLPGMWGGLVNENSPAGVGLLRTICQSKVGRGDAANIPGTIDALCNIARSS
DDWQYMAVDCLIWLVQDASTCHKVIDKVAPTLIDLADISTLGDYKKLGDMIVTVLQECMQ
QSGNSRGAISDQTKAEIDELLRSKQSLKLEKSMPKEDLHIKQAAALVVKLEGNSLFSSGN
IAGAAEKYSEALALCPMKSKKERVVLYSNRAQCYLLLQQPSAAISDATRALCLHSPVNRH
AKSLWRRAQAYDMLGFAKESLLDTILFINECSQSNDPDLSLKQNKVPDYAERLVKKQMRA
AWLFREAALKHGGVRRAGDASDAAFGQEADDSEWETASESDGENGAATGGEADGETGWKN
GGRQEDFCEKS*

MDKIQSDCPYPGCFFCVMKEANPSKRRASVLKYFRELPSQDDDGQVLPISGLWNTAMAHP
NDPEFINLGIFECMASLIWKGLKNRRWLAHDQNIYIPYYAAHIIGSYTMNMEEFAERAVR
AGVIPPLVELLRGRLTWVEQRVAVRALGHLATYPSTFPAVADHGEVLELAIQLASSSLEI
VYSHFYQFVDRRLGYHCDLLTRGMGGVEMESRKAEEWASQLQCWSLQLINCFAFKPEFLH
DICKPDFLVKLPGMWGGLVNENSPAGVGLLRTICQSKVGRGHVANIPATIDALCNIARSS
DDWQYMAVDCLIWLMQDASTCHKVKDIVAPTLIDLSDISALGDYKKLGDTIVTVLQECMQ
QSGNSRGAIGVQTKSEIDELLRSKQSLKLEKSMPKEDLHIKQAAALVVKLEGNSLFSSGN
IAGAAEKYSEALALCPMKSKKERVVLYSNRAQCYLLLQQPLAAISDATRALCLHSPVNRH
AKSLWRRAQAYDMLGLAKESLLDAILFINECSQSNDPDLSLKQNKVPDYAERLVKKQMRS
AWLFREAALKHGGVHCEGDASDAFGQDADDSEWETASESDAENDDTGEADDGTEWKNDGH
REDICEKS*

www.000webhost.com

Other information
Ka divergence:0KaKs divergence:0
GC content 1 (%):48GC content 2 (%):45GC content divergence:-0.032
Length 1 (bp):1836Length 2 (bp):1827Length divergence:-0.002
MFE 1 (kcal):-629.47MFE 2 (kcal):-601.92MFE divergence-0.022