Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:GRMZM2G057369-GRMZM2G492915
Species:maize
Duplication type:WGD
Function (paralog1):LOC100283736
Function (paralog2):

Regulation information
Data set:seedling-drought_Lei_2015
Log2 RF fold difference:-1.2645541097664
Log2 mRNA fold difference:-1.6440898403768
Log2 TE fold difference:0.051812169965739
Sequences
Protein sequence

MSAVNITNVAVLDNPTAFLNPFQFEISYECLVPLDDDLEWKLIYVGSAEDENYDQQLESV
LVGPVNVGTYRFVLQADPPDPSKIREEDIIGVTVLLLTCSYMGQEFMRVGYYVNNDYDDE
QLREEPPAKVLIDRVQRNILADKPRVTKFPINFHPEPSTGPGQQQQEPQTTSPENHTGNG
EANGSKPEADQ*

MSAVNITNVAVLDNPTAFINPFQFEISYECLVPLDDDLEWKLIYVGSAEDENYDQQLESV
LVGPVNVGTYRFVLQADPPDPSKIREEDIIGVTVLLLTCSYMGQEFMRVGYYVNNDYGDE
QLREEPPAKVLIDRVQRNILADKPRVTKFPINFHPEPSTGTGRQQQQQEPQTASPEKHAG
SGEGNGSKPEADQ*

www.000webhost.com

Other information
Ka divergence:0.262059KaKs divergence:0.115987
GC content 1 (%):51GC content 2 (%):54GC content divergence:0.029
Length 1 (bp):576Length 2 (bp):582Length divergence:0.005
MFE 1 (kcal):-188.59MFE 2 (kcal):-207.99MFE divergence0.049