Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:GRMZM2G057374-GRMZM2G068963
Species:maize
Duplication type:WGD
Function (paralog1):FK506 binding protein
Function (paralog2):FK506 binding protein

Regulation information
Data set:seedling_Lei_2015
Log2 RF fold difference:-0.09716615645199
Log2 mRNA fold difference:-0.053135270295944
Log2 TE fold difference:-0.037157799115553
Sequences
Protein sequence

MATFLGSSPALLARPIAKPHISCAQTPRPAIAQNQPPSSEQPEPQKQRHSVQAQPQQAAA
AARPKHAGVADSTDWIASSLTRRSGIGAGLAWAGFLAVGVVSEQLKTRFEVAQQQANTKD
VEQEHEVVLPNGIRYYEMRVGGGDVPRPGDLVVTDLQGRVAGSGGEAFVDTLGDGKRPLA
LVMGSRPYTRGMCEGVEHVVRSMRPGGKRRVVVPPGLAFGDGGADFGEEHVQIPPGATLE
YVVQVDKVSIAPA*

MATFLGSSPALLARPIAKPHISCAQTPRPPSAQNQPPSSEQPQAQTQQQSVQAQPQQATA
RPKRAGGADSTDWVASSLTRRFGIGAGLAWAGFLAVGVVSEQLKTRFEVAQQQANTKDVE
QEQEVVLPNGVRYYEMRVGGGDVPRPGDLVVIDLQGRVAGSGGGGEAFVDTFVDGKRPLA
LVMGSRPYTRGMCEGVEYALRSMRAGGKRRVVVPPGLGFGDDGADFGEEHVQVPPGATLE
YIVQVDRVSIAPA*

Other information
Ka divergence:-0.440818KaKs divergence:0.01804
GC content 1 (%):71GC content 2 (%):72GC content divergence:0.007
Length 1 (bp):762Length 2 (bp):762Length divergence:0
MFE 1 (kcal):-383.81MFE 2 (kcal):-405MFE divergence0.027