Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:GRMZM2G057394-GRMZM2G123459
Species:maize
Duplication type:WGD
Function (paralog1):ATP-dependent RNA helicase DDX23
Function (paralog2):ATP-dependent RNA helicase DDX23

Regulation information
Data set:seedling_Lei_2015
Log2 RF fold difference:-1.0167095735138
Log2 mRNA fold difference:-0.27713294350931
Log2 TE fold difference:-0.73825531536415
Sequences
Protein sequence

MKRSADAMTEPAKPVFLTKAERERLALERRQAAVSDQRRTALDLLQSLPRAPPPPPPSGA
PPSGSNPAPRDSSNSHRDSSDRDRDRDRDRDRDRDRDRDRERRRDDDSRRDRDRDRDRDR
DRDRDRDDSSRRDRDRDRDRRDRDRDRDRDMERERDRDRERGDRGDRERDRLEKMAERER
EKELDAIKEQYLGSKKPKKRVIKPSEKFRFSFDWENTEDTSRDMNALYQSPHEARLLFGR
GFLAGIDRREQKKAAAAHEKETRAELRRKAGVEDRPEDDAVDKKKAAAAEMYDAFDMRVD
RHWSEKALEEMTERDWRIFREDFNISYKGSRIPRPMRKWSESKLGTELLRAIDKAGYEKP
SPIQMAAIPLGLQQRDVIGIAETGSGKTAAFVLPMLSYITRLPPISEENEAEGPYAVVMA
PTRELAQQIEEETVKFATYLGIKVVSIVGGQSIEEQGFKIRQGCEIVIATPGRLLDCLER
RYAVLNQCNYVVLDEADRMIDMGFEPQVVGVLDAMPSSNLKPENEDEELDEKRIYRTTYM
FSATMPPAVERLARKYLRNPVVVTIGTAGKATDLITQNVIMVKESEKMPRLQKILTDLGD
KTAIVFCNTKKTADMRAKDLDKSGFRVTTLHGGKSQDQREISLDGFRNRRFNVLVATDVA
GRGIDIPDVAHVINYEMPSSVDTYTHRIGRTGRAGKKGVATSFLTLENTDIFFDLKQMLI
QSNSPVPPELARHEASKFKPGSIPDRPPRRNDTVFANH*

MKRSADAMTEPVKPVFLTKAERERLALERRQAAVSDQRRTALDLIQSLPRPPPPPTSGGP
PPSGSNPARRDSSNSNRDSDRDRDRDQDRERRRDDDSRRDRYRDRDRDRDRDRDDSSRRD
RDRDRRDRDRDRDRDRDRDRGDRERDRLEKIAEREREKELDAIKEQYLGSKKPKKRVIKP
SEKFRFSFDWENTEDTSRDMNALYQSPHEARLLFGRGFLAGIDRREQKKAAAVHEKETRA
ELRRKAGVEDRPEDDAVDKKKAAAAEIYDAFDMRVDRHWSEKTLEEMTERDWRIFREDFN
ISYKGSRIPRPMRKWSESKLGTELLRAIDKAGYEKPSPIQMAAIPLGLQQRDVIGIAETG
SGKTAAFVLPMLSYITRLPPISEENEAEGPYAVVMAPTRELAQQIEEETVKFATYLGLKV
VSIVGGQSIEEQGFKIRQGCEIVIATPGRLLDCLERRYAVLNQCNYVVLDEADRMIDMGF
EPQVVGVLDAMPSSNLKPENEDEELDEKRIYRTTYMFSATMPPAVERLARKYLRNPVVVT
IGTAGKATDLITQNVIMVKESEKMPRLQKILTDLGDKTAIVFCNTKKTADMRAKDLDKAG
FRVTTLHGGKSQDQREISLDGFRNRRFNVLVATDVAGRGIDIPDVAHVINYEMPSSIDTY
THRIGRTGRAGKKGVASSFLTYENTDIFFDLKQMLMQSNSPVPPELARHEASKFKPGSIP
DRPPRRNDTVFANH*

Other information
Ka divergence:0.582051KaKs divergence:0.679428
GC content 1 (%):54GC content 2 (%):54GC content divergence:0
Length 1 (bp):2277Length 2 (bp):2205Length divergence:-0.016
MFE 1 (kcal):-839.3MFE 2 (kcal):-817.97MFE divergence-0.013