Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:GRMZM2G057642-GRMZM2G003377
Species:maize
Duplication type:WGD
Function (paralog1):hypothetical protein LOC100303796
Function (paralog2):hypothetical protein LOC100276452

Regulation information
Data set:seedling-drought_Lei_2015
Log2 RF fold difference:0
Log2 mRNA fold difference:0
Log2 TE fold difference:0
Sequences
Protein sequence

MAVDEVNSVYVGGLPYEANEEMLRDAFGYYGTIVSVKVINDHAVKGKCYGFVTFTHPRAA
EQAIAGMDGKKLGNRIVRVNEVRTRGPRDFGRDGFRRDPRRYGRDPYWDRRDRERSYDRE
RDPYHDRDSDRSREHDRERDYEHGGFNREIDYPMDRDREGDERRPREHDRTAEMHNVDSD
NDKDKEHVSRKRFSRPKGRDSRDLSSSSDGLQNDGKHQLDKTIQMREDLENEVNQIKDKI
SGKEQHIADLQKKAQKLEDELVAARKVSSERQLAVTDLYKHFLQLQDYNDRVKTAEQRLQ
SLVDAALVELDMAEDATTRDGSMYENGVL*

MDGKKLGNRIIRVNEVRTRGPRDFGRDGFRRDPRRYGRDPYWDRRDREQSYDRERDPYHD
RDSDRSREHDRERDYEHGGFNREVDYPMDRDHEVDDIHPREHDRAAETHNMDSDNDKYKE
HGSRKRFSHPKGRDSKDLSSSSDLQNDGKHQLDKTIQMREDLENEVSQIKDKISAKGQHI
ADLQKKAQKLEDELAAARKVSSERQLAVTDLYKHFLQLQDYNDRVKTAEHRLQSLVDAAM
AELDMAEDATTRDGSMYENGVV*

www.000webhost.com

Other information
Ka divergence:0KaKs divergence:0
GC content 1 (%):46GC content 2 (%):43GC content divergence:-0.034
Length 1 (bp):990Length 2 (bp):789Length divergence:-0.113
MFE 1 (kcal):-302MFE 2 (kcal):-212.84MFE divergence-0.173