Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:GRMZM2G057768-GRMZM2G009163
Species:maize
Duplication type:WGD
Function (paralog1):Ca2+/calmodulin-dependent protein kinase phosphatase
Function (paralog2):hypothetical protein LOC100217306

Regulation information
Data set:seedling-drought_Lei_2015
Log2 RF fold difference:0
Log2 mRNA fold difference:0
Log2 TE fold difference:0
Sequences
Protein sequence

MSGGVEPDTPPGSSSSSSRSGGSTPVGGKPPRHHLTSIRHCASSARIAAASAEFGLESGT
LSLISPTADIRPGFLPVFRSGSFADIGPKSFMEDEHVCVDNLVEHLGLRGPGIPAPGAFY
GVFDGHGGSDAACFVRKNILKFITEDCHFPNSIEKAIRSAFVKADHAIADSQSLDRNSGT
TALTVLISGRTLLVANAGDCRAVLGKRGRAFELSRDHKPSCSVEKLRIENLGGTVFDGYL
NGQLAVARAIGDWHMKGSKGSACPLTPEPEFREVRLTEEDEFLIIGCDGLWDVMSSQFAV
SMVRKELMEHNDPQRCSRELVQEALRRDCCDNLTVVVVCFSDDPPPQIEVPRFRVRRSIS
MEGLHTLRGALDSNV*

MSGGVEPETPPGSSSRSGGSRSVGGKPPRHHLTSIRHCASIARIAAASAGFGLDSGTLSL
ISPTADIHPGFLPVFRSGSFADIGPKTYMEDEHVCVDNLVEHLGFYGPGIPAPGAFYGVF
DGHGGTDAACFVRKNILKFITEDCHFPNSIEKAIRSAFVKADNAIADSHSLDRNSGTTAL
TVLIFGRTLLVANAGDCRAVLGKRGRAVELSRDHKPSCIVERLRIENLGGTVFDGYLNGQ
LAVARAIGDWHMKGSKGSVCPLTPEPEFREVRLTEEDEFLIIGCDGLWDVMSSQFAVSMV
RKELMEHNDPQRCSRELVHEALRRDCCDNLTVVVVCFSADPPPQIEIPRFRVRRSISMEG
LHRLRGALDSNI*

www.000webhost.com

Other information
Ka divergence:0KaKs divergence:0
GC content 1 (%):57GC content 2 (%):54GC content divergence:-0.027
Length 1 (bp):1128Length 2 (bp):1119Length divergence:-0.004
MFE 1 (kcal):-459MFE 2 (kcal):-422.76MFE divergence-0.041