Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:GRMZM2G057789-GRMZM2G081285
Species:maize
Duplication type:WGD
Function (paralog1):hypothetical protein LOC100382012
Function (paralog2):RING-H2 finger protein ATL1R

Regulation information
Data set:seedling_Lei_2015
Log2 RF fold difference:-2.2909277241302
Log2 mRNA fold difference:-3.2924828715962
Log2 TE fold difference:0.97050114430138
Sequences
Protein sequence

MARILVEAPAGSGSPEDSINSDMILILAGLLCALVCVLGLGLVARCACSWRWATESGRAQ
PGAAKAANRGVKKEVLRSLPTVTYVSDSGKAEGGADECAICLAEFEGGQAVRVLPQCGHA
FHAACVDTWLRAHSSCPSCRRVLAVDLPPAERCRRCGARPGAGAGISALWKAPTRCSAEG
PTFLA*

MARILLEAAAGSGPPTDSINSDMILILAGLLCALVCVLGLGLVARCACSWRWAAASRSQP
AADATKAANRGVKKEVLRSLPTVTYVPDSGKAKAAAGADECAICLAEFEEGQAMRVLPQC
GHAFHAACVDTWLRAHSSCPSCRRVLAAPADLPPGEPCRRCGARPGFRALWKAPAPCSAE
GPTFLA*

Other information
Ka divergence:-0.0140822KaKs divergence:0.29683
GC content 1 (%):74GC content 2 (%):76GC content divergence:0.013
Length 1 (bp):558Length 2 (bp):561Length divergence:0.003
MFE 1 (kcal):-304.4MFE 2 (kcal):-308.2MFE divergence0.006