Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:GRMZM2G057823-GRMZM2G066024
Species:maize
Duplication type:WGD
Function (paralog1):Fructose-bisphosphate aldolase, cytoplasmic isozyme (EC 4.1.2.13)
Function (paralog2):fructose-bisphosphate aldolase cytoplasmic isozyme

Regulation information
Data set:seedling-drought_Lei_2015
Log2 RF fold difference:-0.9961378236781
Log2 mRNA fold difference:-1.4272681557235
Log2 TE fold difference:0.42234458257445
Sequences
Protein sequence

MSAYCGKYKDELIKNAAYIGTPGKGILAADESTGTIGKRLSSINVENVEENRRALRELLF
CCPGALQYISGVILFEETLYQKTKDGKPFVDVLKEGGVLPGIKVDKGTIEVVGTDKETTT
QGHDDLGKRCAKYYEAGARFAKWRAVLKIGPNEPSQLAIDLNAQGLARYAIICQENGLVP
IVEPEILVDGPHDIDRCAYVTETVLAACYKALNEHHVLLEGTLLKPNMVTPGSDSKKVTP
EVIAEYTVRTLQRTVPAAVPAVVFLSGGQSEEEATRNLNAMNKLSTKKPWSLSFSFGRAL
QASTLKAWAGKVENLEKARAAFLARCKANSEATLGTYKGDAAADTESLHVKDYKY*

MSAYCGKYADELIKNAAYIGTPGKGILAADESTGTIGKRLSSINVENVEENRRALRELLF
CCPGALQYISGVILFEETLYQKTKDGKPFVDVLKEGGVLPGIKVDKGTIEVVGTDKETTT
QGHDDLGKRCAKYYEAGARFAKWRAVLKIGPNEPSQLAIDLNAQGLARYAIICQENGLVP
IVEPEILVDGPHDIDRCAYVTETVLAACYKALNEHHVLLEGTLLKPNMVTPGSDSKKVTP
EVIAQYTVRTLQRTVPAAVPAVVFLSGGQSEEEATLNLNAMNKLSTKKPWALSFSFGRAL
QASTLKAWAGKVENVEKARAAFLARCKANSEATLGTYKGDAAADTESLHVKDYKY*

Other information
Ka divergence:0.198596KaKs divergence:0.224105
GC content 1 (%):58GC content 2 (%):59GC content divergence:0.009
Length 1 (bp):1068Length 2 (bp):1068Length divergence:0
MFE 1 (kcal):-413.71MFE 2 (kcal):-424.6MFE divergence0.013