Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:GRMZM2G057930-GRMZM2G468661
Species:maize
Duplication type:WGD
Function (paralog1):hypothetical protein LOC100274424
Function (paralog2):

Regulation information
Data set:seedling-drought_Lei_2015
Log2 RF fold difference:-0.71323219153099
Log2 mRNA fold difference:-1.9135034144865
Log2 TE fold difference:0
Sequences
Protein sequence

MRVLAVFLLGAAFAAAAGGGGELPEFREAPAFRNGAACADAPTIHIAMTLDGTYLRGSLA
GVLSVLRHAACPESVAFHFVASSASPARRLASLRRALAAAFPTLPATVHRFDARLVRGKI
SSSVRRALDQPLNYARIYLADLLPRSVSRVLYLDSDLLVVDDVARLWATDLGPDAALAAP
EYCHANFTSYFTDAFWSHPEYTAVFANRTRVPCYFNTGVMVIDLDRWRSGGYTAKLEYWM
EVQKQEARIYELGSLPPFLLVFAGEVKAVEHRWNQHGLGGDNVAGQCRQLHPGPVSLLHW
SGKGKPWLRLDAGRPCPLDALWMPYDLLRRRGARDDLLAAVS*

MRVLAVVLLAAACAAAAAGGGGELPEFREAPAFRNGAACAGAPTIHIAMTLDATYLRGSL
AGVLSVLRHAACPESIAFHFVASSASPARRLASLRRALAAAFPTLPATVHRFDARLVRGK
ISSSVRRALDQPLNYARIYLADLLPRSVPRVLYLDSDLLVVDDVARLWATDLGPDAALAA
PEYCHANFTSYFTDAFWRHPEYAAVFANRTRAPCYFNTGVMVIDLDRWRSGGYTAKLEYW
MEVQKQEARIYELGSLPPFLLVFAGEVKAVGHRWNQHGLGGDNVAGQCRELHPGPVSLLH
WSGKGKPWLRLDAGRPCPLDALWAPYDLLRRRGARDDLLDAVA*

Other information
Ka divergence:-0.471074KaKs divergence:-0.456292
GC content 1 (%):71GC content 2 (%):73GC content divergence:0.014
Length 1 (bp):1029Length 2 (bp):1032Length divergence:0.001
MFE 1 (kcal):-484.47MFE 2 (kcal):-515.9MFE divergence0.031