Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:GRMZM2G058032-GRMZM2G129865
Species:maize
Duplication type:WGD
Function (paralog1):LOC100283149
Function (paralog2):Putative uncharacterized protein

Regulation information
Data set:seedling_Lei_2015
Log2 RF fold difference:-1.5489843002157
Log2 mRNA fold difference:-1.8220389772813
Log2 TE fold difference:0.31597519645918
Sequences
Protein sequence

MPTIIVSVDLECSRCRAKIQRVLNRIQEKGEFCIDDIDFDEKNNKVKVTGPFDPDKLADK
LCCKACKIIKQIEIVEPPPPPPPKPKEEPKKEEQAPPPPEKKEEAAPPPPAKVEPPKEEP
PKEKPPPPKEEPPKEKPPPPKEEKPAPAPPKEEKPAPPPPKVVEVPYPWPYPYPYPAWPS
DCCCHHGHGGCHCCSCGKAPEPAPAPAPAPPPPQYFPQYMPQPYPCNPCGGGYRIVCEED
PSYACAIM*

MPTIIVSVDLECSRCRAKIEKVLNRIQEKGEFCIDDIDLDEKSNKVKVTGPFDPDKLADK
LCCKACKIIKQIEIVEPPPPPPEKPKKEEPAPPPPKKKEEPAPPPPAKVEPPPKEKPPPP
APKEEPKPAPAPAPPPKVVEVPYPWPYPCPYPYPAWPSDCCCHHGHGGCHCCSCGKAPEA
PAPPPMPQYVPQPYPCGGGGGYRIVCDEDPSYACAIM*

Other information
Ka divergence:0.531855KaKs divergence:0.565359
GC content 1 (%):69GC content 2 (%):69GC content divergence:0
Length 1 (bp):747Length 2 (bp):654Length divergence:-0.066
MFE 1 (kcal):-308.1MFE 2 (kcal):-295.44MFE divergence-0.021