Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:GRMZM2G058070-GRMZM5G804323
Species:maize
Duplication type:WGD
Function (paralog1):Oxygen-evolving enhancer protein 3-1, chloroplastic Precursor (OEE3)(16 kDa subunit of oxygen evolving system of photosystem II)(OEC 16 kDa subunit)
Function (paralog2):Oxygen-evolving enhancer protein 3-1

Regulation information
Data set:seedling-drought_Lei_2015
Log2 RF fold difference:-0.72071013196844
Log2 mRNA fold difference:-0.072243619655954
Log2 TE fold difference:-0.58144077846763
Sequences
Protein sequence

MAQAMASMTGLSQGVLPSRRADSRTRTAVVIVRASAEGDAVAQAGRRAVIGLVATGIVGG
ALSQAARAETVKTIKIGAPPPPSGGLPGTLNSDQARDFDLPLKERFYLQPLPPAEAAARV
KTSAQDIINLKPLIDKKAWPYVQNDLRLRASYLRYDLKTVIASKPKEEKKSLKELTGKLF
STIDDLDHAAKIKSTPEAEKYFAATKDALGDVLAKLG*

MAQAMASMTGLSQGVLPSRRAANRARTAAVVRASAEAQAQAQAGRRAVLGLVATGIVGGA
LSQAVHAETVKTIKIGAPPPPSGGLPGTLNSDQARDFDLPLKERFYLQPLPPAEAVARVK
TSAQDIINLKPLIDKKAWPYVQNDLRLRASYLRYDLKTVIASKPKEEKQSLKELTGKLFS
TIDDLDHAAKIKSTPEAEKYFAATKDALGDVLAKLA*

Other information
Ka divergence:0.26562KaKs divergence:0.591711
GC content 1 (%):66GC content 2 (%):67GC content divergence:0.008
Length 1 (bp):654Length 2 (bp):651Length divergence:-0.002
MFE 1 (kcal):-301.3MFE 2 (kcal):-297.3MFE divergence-0.007