Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:GRMZM2G058138-GRMZM2G083262
Species:maize
Duplication type:WGD
Function (paralog1):hypothetical protein LOC100279728
Function (paralog2):hypothetical protein LOC100193869

Regulation information
Data set:seedling_Lei_2015
Log2 RF fold difference:0.39628549879938
Log2 mRNA fold difference:1.1191545067678
Log2 TE fold difference:-0.72826210512254
Sequences
Protein sequence

MPNLECRMYEQRFPEVDAAVMIQVKHIADMGAYVSLLEYNNIEGMILFSELSRRRIRSIS
SLIKVGRQEPAIVLRVDRDKGYIDLSKRRVSEEEAHACEDRYNKSKLVHSIMRHVAETLE
VDLEPLYQRIGWPLYRKYGHAFEAFKLIVADPDAILDVLTYEEKEVGPDGQEVAKVVPAV
TPEVKDSLVKNIRRRMTPQPLKIRADIEMKCFQFDGVLHIKQAMKKAEAAGNDNCPVKIK
LVAPPLYVLTTQTLDKDQGISVLTDAVKACTAEIEKYKGKLVVKEPPRAVSEREDKLFLD
QIDSLMEQNAEVDGDVDSEEEEDTGMGNVDLTNSGVTAY*

MPNLECRMYEQRFPEVDAAVMIQVKHIADMGAYVSLLEYNNIEGMILFSELSRRRIRSIS
SLIKVGRQEPAIVLRVDRDKGYIDLSKRRVSEEEAHACEDRYNKSKLVHSIMRHVAETLE
IDLEPLYQRIGWPLYRKYGHAFEAFKLIVADPDAILDALTYEEKEVGPDGQEVTKVVPAV
TPEVKDSLVKNIRRRMTPQPLKIRADIEMKCFQFDGVLHIKQAMKKAEAAGNDNCPVKIK
LVAPPLYVLTTQTLDKDQGISVLTTAVKACTAEIEKYKGKLVVKEPPRAVSEREDKLFLD
QIDSLMEQNAEVDGDADSEEEEDTGMGDVDITNSGVAAY*

Other information
Ka divergence:-0.192193KaKs divergence:0.0337224
GC content 1 (%):54GC content 2 (%):54GC content divergence:0
Length 1 (bp):1020Length 2 (bp):1020Length divergence:0
MFE 1 (kcal):-376MFE 2 (kcal):-379.24MFE divergence0.004