Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:GRMZM2G058252-GRMZM2G168252
Species:maize
Duplication type:WGD
Function (paralog1):small nuclear ribonucleoprotein F
Function (paralog2):small nuclear ribonucleoprotein F

Regulation information
Data set:seedling_Lei_2015
Log2 RF fold difference:0.57703201978031
Log2 mRNA fold difference:-1.1965982250642
Log2 TE fold difference:1.7224671523965
Sequences
Protein sequence

MFAIHNKVWSYGIYSLISSRFVQTVPVNPKPFLNNLTGKPVIVKLKWGMEYKGYLASVDS
YMNLQLANTEEYIDGQFSGNLGEILIRCNNVMYLRGVPEDAEIEDAE*

MATVPVNPKPFLNNLTGKPVIVKLKWGMEYKGYLASVDSYMNLQLANTEEYIDGQFSGNL
GEILIRCNNVMYLRGVPEDAEIEDAE*

Other information
Ka divergence:-1KaKs divergence:-0.998051
GC content 1 (%):44GC content 2 (%):47GC content divergence:0.033
Length 1 (bp):324Length 2 (bp):261Length divergence:-0.108
MFE 1 (kcal):-94.3MFE 2 (kcal):-75.73MFE divergence-0.109