Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:GRMZM2G058518-GRMZM2G134717
Species:maize
Duplication type:WGD
Function (paralog1):ANAC010
Function (paralog2):

Regulation information
Data set:seedling_Lei_2015
Log2 RF fold difference:-0.16935105296782
Log2 mRNA fold difference:-1.6710524161007
Log2 TE fold difference:1.5472178499436
Sequences
Protein sequence

MTWCNSFNDVRAVENNLATAAAVAAAAAKKQQQQQASSHVNLIRTCPSCGHRAQYEQVQA
AATIQDLPGLPAGVKFDPTDQELLEHLEGKARPDARKLHHPLIDEFIPTIEGENGICYTH
PERLPGVGKDGLIRHFFHRPSKAYTTGTRKRRKVHTDEQGGETRWHKTGKTRPVFTGGKL
KGYKKILVLYTNYGKQRKPEKTNWVMHQYHLGSDEEEKDGELVVSKVFYQTQPRQCGSGS
ATAKDAIPLAANAATDHHHHHHHDGGNGGGNNMLKEAGIVDFYSPAALISYNQAASNSRV
AASAHLVPNFEVHTTSGAAGFGP*

MTWCNSFNDVRAVEDNLATAAAAKKQQLQASSHVNLIRTCPSCGHRAQYDEQVQQAAAIQ
DLPGLPAGVKFDPTDQELLEHLEGKARPDTRKLHPLVDEFIPTIEGENGICYTHPERLPG
Q*

Other information
Ka divergence:0.81648KaKs divergence:0.530631
GC content 1 (%):62GC content 2 (%):66GC content divergence:0.031
Length 1 (bp):972Length 2 (bp):366Length divergence:-0.453
MFE 1 (kcal):-396.03MFE 2 (kcal):-148.4MFE divergence-0.455