Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:GRMZM2G058702-GRMZM2G117786
Species:maize
Duplication type:WGD
Function (paralog1):hypothetical protein LOC100272519
Function (paralog2):hypothetical protein LOC100279373

Regulation information
Data set:seedling-drought_Lei_2015
Log2 RF fold difference:1.864832381359
Log2 mRNA fold difference:2.9761771822761
Log2 TE fold difference:-1.5899180868627
Sequences
Protein sequence

MATAPASLSLSASTLPTRLRAAAVLAGMRWRQPQRGRMVVRAKIREIFMPALSSTMTEGK
IVSWSAGEGDRVSKGDAVVVVESDKADMDVETFHDGIVAVVLVQAGESAPVGAPIALLAE
SEEEVPLALAKAQELSNGQPQQAPPAPTEDAAATPPPPSAPATAPTPVAVGTKGIASPHA
KKLAKQHRVDLAKVTGTGPYGRITSADVEAAAGIQPKSKPAPAAAAPPPVAAPSVGAVPQ
SAVLPPVPGATVVPFTTMQAAVSKNMVESLAVPAFRVGYPIITDKLDELYEKVKPKGVTM
TVLLAKAAAMALAQHPVVNASCRDGKSFTYNSNINIAVAVAIDGGLITPVLQDADKLDIY
LLSQNWKDLVKKARAKQLQPNEYSSGTFTLSNLGMFGVDRFDAILPPGQGAIMAVGASKP
TVVADKDGFFSVKSKMLVNVTADHRIVYGADLAAFLQTFAKVIEDPESLTL*

MATAPAPLSLSASTLPARLRAGVVPAGTRWRQPRRGRMVVRAKIREIFMPALSSTMTEGK
IVSWSAGEGDRVSKGDAVVVVESDKADMDVETFHDGIVAVVLVQAGESAPVGAPIALLAE
SEEEVPLALAKAQELSNGQPQQAPPAPTEDAAAAPPPLPAATTAPAPVAAGTKGITSPHA
KKLAKQHRVDLAKITGTGPYGRITPADIEAAAGIKPKSEPTPAAAAAPPPVAAPSVGAVP
QAAVLPPVPGATVVPFTTMQAAVSKNMVESLAVPAFRVGYPIVTDKLDELYEKVKPKGVT
MTVLLAKAAAMALAQHPVVNSTCRDGKSFTYNSNINIAVAVAIDGGLITPVLQDADKLDI
YLLSQNWKDLVKKARAKQLQPNDYNSGTFTLSNLGMFGVDRFDAILPPGQGAIMAVGASK
PTVVADKDGFFSVKSKMLVNVTADHRIVYGADLAAFLQTFAKIIEDPESLTL*

www.000webhost.com

Other information
Ka divergence:0.159856KaKs divergence:-0.0214844
GC content 1 (%):58GC content 2 (%):58GC content divergence:0
Length 1 (bp):1416Length 2 (bp):1419Length divergence:0.001
MFE 1 (kcal):-607.26MFE 2 (kcal):-608.44MFE divergence0.001