Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:GRMZM2G058910-GRMZM2G104418
Species:maize
Duplication type:WGD
Function (paralog1):Putative uncharacterized protein
Function (paralog2):Putative uncharacterized protein

Regulation information
Data set:seedling-drought_Lei_2015
Log2 RF fold difference:-0.46285679389218
Log2 mRNA fold difference:1.2068926315348
Log2 TE fold difference:-1.6679643749774
Sequences
Protein sequence

MARGGGGGCCPPMDLMRSEAMQLVQVIIPAESAHLTVSYLGDLGLLQFKDLNIDKSPFQR
TYAAQIKRCSEMARKLRFFKEQMSKADITASPTQLNGTHMDFDELEIKLGELEAELTEVN
ANNEKLQRTYNELLEYHTVLQKAGEFFYSAQRTAAAQQMEMEANQSGQTSLESPLLEQEM
TTDPSKQVKLGSLSGLVPKEKAMAFERILFRATRGNIFLRQEPVDEPVTDPVSREKVTKN
AFVIFYSGERAKTKILKICDAFNANRYPFPEDVGKQLHAVQEVSGKISELKTTIDMGLAH
RDSILKNIASDFEQWNHLVKKEKAIYHTLNMLSVDVTKKCLVAEGWSPIFASIQIQDALQ
RATLDSKSQVGSIFQVLNTKESPPTYFQTNKFTSAFQEIVDAYGVAKYQEANPGVFTIVT
FPFLFAVMFGDWGHGICLLLATLYLIIREKKLASQKLGDIMEMMFGGRYVIMMMAVFSIY
TGLIYNEFFSVPFGLFGKSAYACRDSSCSDATTEGLLKVRDAYPFGVDPVWHGSRSELPF
LNSLKMKMSILLGVAQMNLGIVISYFNAKFFRNSINVWYQFIPQLIFLNSLFGYLSLLII
IKWCTGSKADLYHVMIYMFLSPTDDLSENQLFSGQKTVQLVLLLLALVSVPWMLIPKPLL
LKKQHQQRHQGHQYAMLQGIDESVGAELGEHHEDAHDHEEFEFGEVFVHQLIHTIEFVLG
AVSNTASYLRLWALSLAHSELSTVFYEKVLMTAYGFNNVFILIIGVVIFIFATIGVLLVM
ETLSAFLHALRLHWVEFQNKFYEGDGYKFAPFSFALIREEED*

MFGDWGHGICLLLATLYLIIREKKLASQKLGDIMEMMFGGRYVIMMMAVFSIYTGLIYNE
FFSVPFGLFGKSAYACRDSSCSDATTEGLIKVRDAYPFGVDPVWHGSRSELPFLNSLKMK
MSILLGVAQMNLGIVISYFNAKFFRNSLNVWYQFIPQLIFLNSLFGYLSLLIIIKWCTGS
KADLYHVMIYMFLSPTDEIGENQLFSGQKTVQLVLLLLALVSVPWMLIPKPLLLKKQHQQ
RHQGHQYAMLQGVDESVGAELGEHHEEAHDHEEFEFSEVFVHQLIHTIEFVLGAVSNTAS
YLRLWALSLAHSELSTVFYDKVLLMAWGFNNVIILIIGIIVFIFATVGVLLVMETLSAFL
HALRLHWVEFQNKFYEGDGYKFAPFSFALIREEED*

Other information
Ka divergence:-0.237506KaKs divergence:-0.0888889
GC content 1 (%):43GC content 2 (%):43GC content divergence:0
Length 1 (bp):2469Length 2 (bp):1188Length divergence:-0.35
MFE 1 (kcal):-755.08MFE 2 (kcal):-365.44MFE divergence-0.348