Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:GRMZM2G059083-GRMZM2G059191
Species:maize
Duplication type:WGD
Function (paralog1):ferredoxin
Function (paralog2):ferredoxin--NADP reductase, leaf isozyme

Regulation information
Data set:seedling_Lei_2015
Log2 RF fold difference:0.25128983444415
Log2 mRNA fold difference:0.094193246132112
Log2 TE fold difference:0.16116842034404
Sequences
Protein sequence

MAAVTAAAVSLPSSSSSPAAAKAKASASASPSSPCGHLQFPRRHGGPRAVRLRVQVSTTE
TAEAEPVKKLEKVSKKQEEGLVTNKYKPKEPYVGRCLLNTRITGDQAPGETWHMVFSTEG
EVPYREGQSIGVIADGEDKNGKPHKLRLYSIASSALGDFGDSKTVSLCVKRLVYTNDQGE
VVKGVCSNFLCDLKPGAEVKITGPVGKEMLMPKDPNATIIMLATGTGIAPFRSFLWKMFF
EEHEDYKYTGLAWLFLGVPTSDTLLYKEELEKMKEMAPDNFRLDFAVSREQTNAAGEKMY
IQTRMAEYKEELWELLKKDNTYVYMCGLKGMEKGIDDIMLDLAAKDGINWLDYKKQLKKS
EQWNVEVY*

MAAVTAAAISLSSSSASSPAAAAKAKAASPSSSPCRHLQFLSAASPRRRWRAGARAVRAQ
VSTTETAAAGPAKTSKKQDEGLVTNKYKPKEPYVGRCLSNTRITGDDAPGETWHMVFSTE
GEIPYREGQSIGIIADGEDKNGKPHKLRLYSIASSALGDFGDSKTVSLCVKRLVYTNDQG
EIVKGVCSNFLCDLKPGADVKITGPVGKEMLMPKDPNATVIMLATGTGIAPFRSFLWKMF
LEEHEDYKFSGLAWLFLGVPTSDSLLYKEELEKMKEMAPDNFRLDFAVSREQTNAAGEKM
YIQTRMAEYREELWELLKKDNTYVYMCGLKGMEKGIDDIMLNLAAKDGIDWMQYKKQLKK
GEQWNVEVY*

Other information
Ka divergence:0.325358KaKs divergence:-0.0195704
GC content 1 (%):62GC content 2 (%):62GC content divergence:0
Length 1 (bp):1107Length 2 (bp):1110Length divergence:0.001
MFE 1 (kcal):-476.56MFE 2 (kcal):-492.8MFE divergence0.017