Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:GRMZM2G059353-GRMZM2G166441
Species:maize
Duplication type:WGD
Function (paralog1):hypothetical protein LOC100193823
Function (paralog2):hypothetical protein LOC100273380

Regulation information
Data set:seedling_Lei_2015
Log2 RF fold difference:-1.3265317826873
Log2 mRNA fold difference:-0.17116244529575
Log2 TE fold difference:-1.1546080624807
Sequences
Protein sequence

MAATLLHAATASLQSSSQPARAGAATAFHPLASTPSIRLARSSFSSNRRLEVSLRAVSAG
HCFAGRGAPRGRRVVAALAGEQTEGSEVGDDKDNSNEEIKPEEAQEAWKVMLEQFKAEAL
RMQALSMQAYDVYSKRAREVLLEASEKLKIQADKAQKDLSVIATEVSQEGQEYLVMAARN
SPDSIKDITTTFRALGRLNWPSEYEDYHVGIPFGTFLTVGGFLNFMLTGSTSALRFGIVL
GLALLTLGISSLRSHREGDRRPRLLVKGQAAIALVIFFREFSVLLQNGWFPKIFIVLLSG
VVAAFYFYRIATGNPKDLSSKNDSAN*

MAASLLHASAAAASLLSSTQHARAGAAAFHPLACAPSLRLTRSSFSTNRHLEISLRAISA
SRRFAGRGAPRDRRVVAALAGEQTSLECWCWMQEGSEVGDDRNGEIKPEEAQEIWKVMLE
QFKAEALRMQALSMQAYDVYSERTREVLLEASEKLKIQADKAQKDLSVVATEIGQEGQEY
LMMAARNSPDSIKDITTTFRALGKLNWPSEYEDYHVGIPFGTFLTVGGFLNFMLAGSTSA
LRFGIILGLALLALGISSLRSQRDGGRRPRLLVKGQAAIASVIFFREFSVLLQNGWFPKI
FMVLLSGVVAGFYFYRIAAGSPKELSSNSDSVN*

Other information
Ka divergence:0.133179KaKs divergence:0.0748849
GC content 1 (%):54GC content 2 (%):56GC content divergence:0.018
Length 1 (bp):981Length 2 (bp):1002Length divergence:0.011
MFE 1 (kcal):-364.31MFE 2 (kcal):-374.7MFE divergence0.014