Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:GRMZM2G059562-GRMZM2G468056
Species:maize
Duplication type:WGD
Function (paralog1):
Function (paralog2):Putative uncharacterized protein

Regulation information
Data set:seedling-drought_Lei_2015
Log2 RF fold difference:0.23529223458532
Log2 mRNA fold difference:-0.77852560462153
Log2 TE fold difference:0.85038753766895
Sequences
Protein sequence

MTLDTPAAVVLELMTMGQQSASHLGDLLRAASPAAASPHQELAAEILRCCGRVIDALRAA
GRKRKAAEYQDAAAARCAWSSPPPPPGPPAKRARGAEATMEVTSGTAVDGFIWRKYGQKD
INGHKHPRLYYRCAHKDQGCNATRRVQQTREQPAAYEIAYYGEHTCRGAWQQGGAAAAAV
APPAVVDFGSSSWGSAADTSRSSPSQGGWSSPSASSEAGVGFGPQLAHEWHDTAAPDPVT
EFLDGCFGWESVLQDRFDFGGLSDVATFQQ*

MTLDTPAAVVLELMTMGQQSAAHLGDLLRAASPAAASPHQELAAEILRCCGRVIDALRAA
AAASGHKRKAAAEYQDAAAGGGASPPPPPPPPGPPLKRRLYYRCAHKDQGCDATRRVQRT
REQPAAYEIAYYGDHTCRGAATAWQQGAPAPAVVDFGSNSWGSADTTSGGSPASVPLGGW
WSPSASSEVGFEAHAAAHEWRDTAAAAPDPVMEFLDGAFGWESVLEDRFDLGGLHGIATF
Q*

Other information
Ka divergence:0.0294771KaKs divergence:0.21712
GC content 1 (%):71GC content 2 (%):72GC content divergence:0.007
Length 1 (bp):813Length 2 (bp):726Length divergence:-0.057
MFE 1 (kcal):-437.21MFE 2 (kcal):-383.84MFE divergence-0.065