Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:GRMZM2G059637-GRMZM2G166176
Species:maize
Duplication type:WGD
Function (paralog1):hypothetical protein LOC100191740
Function (paralog2):hypothetical protein LOC100280283

Regulation information
Data set:seedling-drought_Lei_2015
Log2 RF fold difference:-1.4705929162679
Log2 mRNA fold difference:-0.03277828713047
Log2 TE fold difference:-1.5801037463507
Sequences
Protein sequence

MTPASQAAPPRARRSVVAELEGALLRSADTLPYFMLVAFEASGLPRFALLLALCPLLRLL
ELAGRGGLALRAAAFVATAGVTRAELEAVSRAVLPKFMADDVDPAAWAAFGSCEGRRVVV
TRMPRVMVERFAKEHLGAHAVVGSDLEYSRLRRSTGLLKGACHEAVASRARALFAGDDLP
DLAIAGSEMARSFTFCEEQISPPFTGDHGMNAAPPFRPVIFHDGRLVCRPTPFMSLVILL
WLPLGVLVAFVRIAVGLMVPIWSIPYIAPVFGGAVIIHGRAPPPVRPSDAADVGSPPSGV
LFVCTHRTLMDPVVLATVLGRRVAAVTYSISRLSEILSPIPTVRLTRDREVDAARMRAEL
ASGDVAVCPEGTTCREPFLLRFSKLFAELSDRIVPVAMNYRVGLFHPTTARGWKAMDPIF
FFMNPRPVYEVTFLNQLPAEATCAAGKSPVDVANYVQRILAATLGFECTTLTRKDKYTVL
AGNDGVLNAKPAAAGKPAWQSRVKEVLGFLLH*

MQTTTTTSSVVAELEGALLRSADTFPYFMLVAFEASGLPRFALLLALWPLLRLLELAGRR
GLALRAAAFVATAGVPRAEVEAVSRAVLPKFMADDVDPAAWAAFGSCEGTRVVVTRMPRV
MVDRFAREHLGAHAVVGCDLEYSRLRRSTGLLRGASYEDVATRVRALFAGDGCRPALGIG
GSKMARSFLTFCEEQLRQPFPAPNETNAPPFRPVIFHDGRLVCRPTPFMSLVILLWLPLG
VLVAFVRIAVGLMVPIWTVPYIAPVFGGAVITHGRAPPPAKLGGGSPSGVLFVCTHRTLM
DPVVLAAVLGRRVAAVTYSISRLSEVLSPIPTVRLTRDRDADAARMRAELARGGDVAVCP
EGTTCREPFLLRFSKLFAELSDSIVPVAMNYRVGLFHPTTARGWKAMDPIFFFMNPRPVY
EVTFLNQLPAESTCAAGKSPVDVANYVQRILAATLGFECTTLTRKDKYTVLAGNDGVVNA
KPACWQSRVKDVLGFLLH*

Other information
Ka divergence:0.0387792KaKs divergence:0.031906
GC content 1 (%):71GC content 2 (%):71GC content divergence:0
Length 1 (bp):1539Length 2 (bp):1497Length divergence:-0.014
MFE 1 (kcal):-792.81MFE 2 (kcal):-799.2MFE divergence0.004