Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:GRMZM2G059740-GRMZM2G076212
Species:maize
Duplication type:TD
Function (paralog1):hypothetical protein LOC100272781
Function (paralog2):

Regulation information
Data set:seedling_Lei_2015
Log2 RF fold difference:-0.96340040933838
Log2 mRNA fold difference:-1.7411521761371
Log2 TE fold difference:0.72467685351209
Sequences
Protein sequence

MGNAAVAIISSVSATATVVVMIALIRRCRVVRKKIKKKIVKKVLEEIERKNRVGAACDAL
EDVVIEIGPVEKFLNEILNEKPMRFSSEQLAACTKNYSSELGSGGYGVVYKGELPNGLLV
AVKVLKVSMNKKVQEAFMAEIGTIGRTYHVHLVRLYGFCFDADTKALVYEFLEKGSLEKY
LYCDEGSTATRLEWATLHGIAVGTAKGIRYLHEECQQRIVHYDIKPANILLTADYTPKVA
DFGLARLGERENTHMSLTGGGRGTPGYAAPELWMALPASEKCDVYSFGMVLFEILGRRRN
YDPCQGESKEWFPRWVWERYAQGEIEDVVACDGIVGDADREKAEMMCKVALWCVQFQPSA
RPTMSSVVRMLEGEMAIVPPVNPFHYVMESSSASTSSGLWSGTYQSSRDTTARESELSAS
PAAKSTDAMIEDVERAYASVLAKQSL*

MGNALAIITTIIVSKRMKKKIIKKVLEEIEKKNRETQASNNAVEDAVIEVGPVETFLNQI
LNEKPMRFSSEQLAACTRNYSSELGSGGYGTVYKGELPNGLLVAVKVLKVSMNKKVQEAF
MAEIGTIGRTYHVHLVRLYGFCFDANTKALVYEYLEKGSLEKYLYYGDVECSTSTGKRLE
WGTLHGIAVGTAKGIRYLHEECQQRIVHYDIKPANILLTADDTPKVADFGLARLGEREDT
HMSLTGGGRGTPGYAAPELWMALPASEKCDVYSFGMVLFEILGQRRNYDPCRGESREWFP
RWVWERYEQGEIEYVVSCDGIGEADMEKAEIMCKVALWCVQFQPAARPTMSSVVRMLEGE
MPIVPPVNPFHYVMDSSSGSTSSGLWSDTYQSSRETIGIAIDSELSVSPIAKST*

Other information
Ka divergence:0.360872KaKs divergence:0.402848
GC content 1 (%):62GC content 2 (%):60GC content divergence:-0.016
Length 1 (bp):1341Length 2 (bp):1245Length divergence:-0.037
MFE 1 (kcal):-573.3MFE 2 (kcal):-524.3MFE divergence-0.045