Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:GRMZM2G059753-GRMZM2G025966
Species:maize
Duplication type:WGD
Function (paralog1):hypothetical protein LOC100276848
Function (paralog2):

Regulation information
Data set:seedling-drought_Lei_2015
Log2 RF fold difference:0
Log2 mRNA fold difference:0
Log2 TE fold difference:0
Sequences
Protein sequence

MEISFEAWEGVQRHGQDLADRLAQGFTGLLQAPPQFPWPPAPHKRMPFDIDLPVVPFGAG
VPKKDLPFPAAAAAVSSVIDIGGRLGQAGAELGASVGGAVQHAVRHLPVPFRNAQIRRRT
LPPAPPQAPLPPATSVGEGAAGRSVERAAVDRCPLEAAAAAAAAATGSAAASSVSGHVSG
DDLDEDDEGFGCGIGTLGNFKKANGTVNMSATYNSRSQDIESSVVAHGDLWRLEASRGGS
TSGNGTSPLYLVQLGPLLFVRDSTLLLPVHLSKQHLLWYGYDRKNGVHSLCPAIWSKHRR
WLMMSMMCLNPIACSFMDLQFPNGQLTYVAGEGISASGFLPLFGGLLQAQGKYPGETRVS
FSCKNKRGTRFTPMFQWPDKSVSLGVTQALAWKRSGLMVRPSIQVSVCPTFGGSDPGVRA
EVVHSLKEELNLMCGLSCSRHPSAYTALSIGRSKWNGQVGSSGVVITLETPLNNIGRPSL
SVQLNGGFEL*

MEISFEAWEGVQRHGQDLADRLAQGFTGLLQVPPQFPWPPSPHKRMPFDIDLPVVPFGAG
GPLGVPGKDFPFPAAAVSSVIDIGGRLGQAGAELGASVGGAVQHAVRRLPVPFRNGQIRR
RKLPPPLPQPPADSVGEGAVGLFVERAAVDRCPLEAAAAAAAAATGSAAASSVSGPVSGE
DLDEDDDGFGCDIGTLGNFKKANGTVNMSATYNTRSQDIESSVVARGGLWRLEASVGPST
SGNDTSPLYLIQLGPLLFVRDSTLLLPVHLSKQHLLWYGYDRKNGVHSLCPAIWSKHRRW
LMMSMMCLNPIACSFMDLQFPNGQLTYVAGEGISASGFLPLFGGLLQAHGKYPGETRVSF
SCKNKRGTRFTPMVQWPDKSVSLGVTQALAWKRSGLMVRPSIQVSVCPTFGGSDPGVRAE
VVHSLKEELNLMCGLSCSQRPSAYTALSIGRSKWNGQVGSSGVVITLETPLNNIGRPSLS
VQLNGGFEL*

www.000webhost.com

Other information
Ka divergence:0KaKs divergence:0
GC content 1 (%):56GC content 2 (%):55GC content divergence:-0.009
Length 1 (bp):1473Length 2 (bp):1470Length divergence:-0.001
MFE 1 (kcal):-610.44MFE 2 (kcal):-602.85MFE divergence-0.006