Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:GRMZM2G059985-GRMZM2G144088
Species:maize
Duplication type:WGD
Function (paralog1):
Function (paralog2):hypothetical protein LOC100277074

Regulation information
Data set:seedling-drought_Lei_2015
Log2 RF fold difference:2.3227609787349
Log2 mRNA fold difference:3.4937718820995
Log2 TE fold difference:-1.1819611187049
Sequences
Protein sequence

MAMSLSRFSQWIWPGSRTRNPRGREPPAGSTALTEGLFPDSPSGFRDPDPGSGAAQRRKG
KSRRRGGRVEAKVDGEHGMVIVQSDGDGCLSDSDSDGSDWSIGWLEPLAPDLQSDVDSEG
SFAVLVRCYRRGRADRPDRPDGKFPAPGGVAHGHGGVSGNKNFVEQ*

MSLSRFSQWIWPGSRARNRRGRDREPPAWSSTAVTKGLFPDSPSGFREPDAGVGRTGMIS
RRGGRAEDRVDSEHGMVIVQSDGDGCLSDSDSDASDWSIGWLEPLAPDLHSDVDSEGSFA
VLVPCYRRGRVDRPARPDGRFPGPGGVPAHGGVSDNRTSVEQWVSSLQN*

Other information
Ka divergence:0.0924706KaKs divergence:-0.132221
GC content 1 (%):65GC content 2 (%):67GC content divergence:0.015
Length 1 (bp):501Length 2 (bp):510Length divergence:0.009
MFE 1 (kcal):-245.9MFE 2 (kcal):-249.8MFE divergence0.008