Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:GRMZM2G060255-GRMZM2G114057
Species:maize
Duplication type:WGD
Function (paralog1):LOC100284725
Function (paralog2):hypothetical protein LOC100193959

Regulation information
Data set:seedling_Lei_2015
Log2 RF fold difference:-1.3471203442917
Log2 mRNA fold difference:-1.6991540668538
Log2 TE fold difference:0.37254046946966
Sequences
Protein sequence

MASSAGNRFLRQLSASNGDEAVCGGLQMDQQEYGGAGVGRRGSRRWSKKRAAAAAAARGY
GAGSGNGVKQPASAAGKRVMVVVDESSGANHAMMWALTHVADKGDFLTLLHVLPRSGSGR
GEEASSLANSLGTLCKASRPEVEVEALVIQGPKLGTVLSQVKKLEASVLVLSQCRPSPCW
LSCFLRSSGEEFVEQCINQAECLTLAVRKQSKGVGGYLISTRWQKNFWLLA*

MASSAEERFLRQLSASNGGDEGVCGGQQLGHKEYCAERRGSRRWSRKRAAAARGYCGGYD
DYDVKQQAEAASAAARKRVIVVVDDTSGSKHAMMWALTHVASKGDFLTLLHVLLPHSASG
GGCSRGEEASSLANSLGTLCKASRPEVEVEALVIQGPKLGTVLSQVKKLEASVLVLGQGR
PSPCYRWLSCFLRSSSEEFVEQCIDQAECLTLAVRKQSKAVGGYLVSTRWQKNFWLLA*

Other information
Ka divergence:0.364048KaKs divergence:-0.146352
GC content 1 (%):69GC content 2 (%):69GC content divergence:0
Length 1 (bp):696Length 2 (bp):717Length divergence:0.015
MFE 1 (kcal):-359.8MFE 2 (kcal):-374.9MFE divergence0.021