Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:GRMZM2G060540-GRMZM2G133926
Species:maize
Duplication type:WGD
Function (paralog1):
Function (paralog2):

Regulation information
Data set:seedling_Lei_2015
Log2 RF fold difference:-1.1781920704692
Log2 mRNA fold difference:-1.5416784507323
Log2 TE fold difference:0.40180562654617
Sequences
Protein sequence

MAKPRRGRSASRSSSGSSSRSLSHSVSSGSVSSRSRSRSRSFSSSSSQSRSRSPPQAKRS
SPGARKGRSPSPPPKKGSPSKKVRSPSPPLKKASPPRKVSPPAESAVLCIDHLSRNVNEA
HLKEIFGNFGEVVNVELSMDRMVNLPRGYGYIEFKKRADAEKALLHMDGGQIDGNIVKLR
FTLQPRQRAASPVKAPPPPPKRDALQIEKGVSSAEKDAQQRPKESSPRRKPASPLRKRSP
NRRAESPRRPPDPSPRRRPDSPPIRRRPDPSPVRRGDTPRRRPPSPVRRRSPSPPPRRHR
SPMRLSPRRGRGSPSPRRRSPGPLRRRSPPPRRLRSPPRRPPPPRRFSRSPPRRPLRSRS
RSISPRRGRGPPLRRGRSDSSYSRSPTPPPRKGPRRVSRSRSPRKPPRAGRSVSSDSRSS
SSPSPRRGR*

MAKPRRGRSASRSTSGSSSRSPSHSVSSGSVSSRSRSFSSSSSQSRSRSPPPAKRSSPGA
RKGRSPSPPPKKGSPSKKVRSPSPPPKKASPPRKASPPAESVVLCIDHLSRNVNEAHLKE
IFGNFGEVVNVELSMDRMVNLPRGYGYIEFKKRADAEKALLYMDGGQIDGNVVKLRFTLQ
PRQRAVSPMKAPPPPPKRDVAQIEKGLSSAEKDAQQRPRESSPRRKPASPPRKRSPNRRA
ESPRRPPDPSPRRRPDSPPIRRRPDPSPVRRGGTPPRRRPLSPVRRRSPSPPRRHRSPMR
PSPRRGRGSPSPRRRSPGPLRRRSPPPRRLRSPPRRPPPPRRYSRSPPRRPLRSRSISPR
RGRGPLLRRGRSGSSYSRSPTPPPRKGPRRVSRSRSPRRPPRGRSISSDSRSSSSPSPRR
GR*

Other information
Ka divergence:-0.3088KaKs divergence:-0.573409
GC content 1 (%):56GC content 2 (%):56GC content divergence:0
Length 1 (bp):1290Length 2 (bp):1269Length divergence:-0.008
MFE 1 (kcal):-442.1MFE 2 (kcal):-437.3MFE divergence-0.005