Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:GRMZM2G060742-GRMZM2G347174
Species:maize
Duplication type:WGD
Function (paralog1):citrate transporter family protein
Function (paralog2):

Regulation information
Data set:seedling_Lei_2015
Log2 RF fold difference:-1.7319090061785
Log2 mRNA fold difference:-2.7413752050947
Log2 TE fold difference:1.1299664935015
Sequences
Protein sequence

MTLASTDKVVLGCIAFSIFWVLAVFPSVPFMPVGRTAGSLLGAMLMVLFRVMTPEEAYKA
IDLPILGLLFGTMVVSIFLERADMFKYLGSALAWRSRGSKDLLFRVCLVSAVASALFTND
TCCVVLTEFILKLARQNNLPPQPFLLALASSSNIGSSATPIGNPQNLVIAVQSGITFGQF
LVGVFPAMIVGVAANTCILLCYFWRCLSAPEKDQEGGAAAAGPDVAVVADEEVTSHRFTP
ARMSRASSVNGGGADADCVGELIRRSDSLSRADTTLGMSMRSRSYNSEGGDIQVAIRSMR
ASSMSQEMVEVSTVCDRRDDGGAGPRKVTRTTSHQRSVIIEDAPEADAADDDDDGHKGKD
GDSVTNKEKRWKVLVWKTAVYLTTLGMLAALLMGLNMSWSAITAALVLLALDFTDAQACL
EKVSYSLLIFFCGMFITVDGFNRTGIPNALWELVEPHSRIDSAKGTALLAVVILVLSNVA
SNVPTVLLLGTRVAASAGTISPESEKKAWLILAWVSTVAGNLTLLGSAANLIVCEQARRA
QFFGYNLTFWSHLRFGLPSTIIITAIGLLIVASY*

MPSSVVTNSPRGSRQEQGRPLVPRLTTQRSHECGIGRRRDDTWVIYHPPIRRLAAGRRAR
EYEAMTLASTDKVVLGCVAFSIFWVLAVFPSVPFMPVGRTAGSLLGAMLMVLFRVMTPDE
AYKAIDLPILGLLFGTMVVSIFLERADMFEYLGGALAWRSRGSKDLLLRVCLVSAVASAL
FTNDTCCVVLTEFILKLARQNGLPPQPFLLALASSSNIGSAATPIGNPQNLVIAVQSGIT
FGQFLVGVFPAMAVGVAANTCVLLCYFWRYLAAPEKDQEAGPDAVVADEEVTSHRFTPAR
MSHASSMNGGFDGDCVSEPMRRSESLGRADALRSRSYNSEGDIQVSIRSMRASSLSQEMV
DVSTVGDGPRKITRSTSQQRSVIIEDAPPEADDDAHKGKDGDDDDVKVKRWKVVVWKSAV
YLTTLGMLVALLMGLNMSWSAITAALVLLALDFTDAQACLEKVSYSLLIFFCGMFITVDG
FNKTGIPNALWELVEPYSRIDSARGTALLALVILVLSNVASNVPTVLLLGSRVAASAAAI
SPESQKKAWLILAWVSTVSGNLTLLGSAANLIVCEQARRAQFFGYNLTFWSHLRFGLPST
IIVTAIGLLIVVSY*

Other information
Ka divergence:-0.0617855KaKs divergence:0.0466989
GC content 1 (%):65GC content 2 (%):66GC content divergence:0.008
Length 1 (bp):1725Length 2 (bp):1845Length divergence:0.034
MFE 1 (kcal):-803.21MFE 2 (kcal):-859.52MFE divergence0.034