Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:GRMZM2G060765-GRMZM2G166049
Species:maize
Duplication type:WGD
Function (paralog1):hypothetical protein LOC100273191
Function (paralog2):hypothetical protein LOC100272712

Regulation information
Data set:seedling-drought_Lei_2015
Log2 RF fold difference:0.23240382450462
Log2 mRNA fold difference:0.11568414302375
Log2 TE fold difference:0.17518325855444
Sequences
Protein sequence

MEDEDAGLGDGGEASPPHHAAASGDRARDLAASPTSSRSVTQTVNGSHRFVIQGYSLAKG
MGVGKHIASDTFTVGGYQWAIYFYPDGKNPEDNSGYVSVFIALASDGTDVRALFELTLLD
QSGKGKHKVHSHFDRSLESGPYTLKYRGSMWGYKRFFRRNALEQSDFLKDDCLKINCTVG
VVVSTMDYSRPHSIEVPESDIGYHFGTLLDTLEGVDVIFSVAGEKFHAHKLVLAARSSFF
RSEFFDHESDEEKNETGTGDEIKEIVIDDMDPVVFKAVLHFMYRDNLVNDDELMASSSDC
SIFDSLAGKLMAAADKYELPRLRLLCESYLCKHVSVNSVATTLALADRYHAIELKSVCLK
FAAENLSAVIRTEGFDYLKDNCPSLQSEILRTVAGCEEQCSSGVKSQSVWAQLSDGGDTS
GRRVRPRV*

MEDEDTGPGDGGEASPPHHVAASSDRARDMVASPTSSRSVTQTVNGSHHFVIQGYSLAKG
MGVGKHIASETFTVGGYQWAIYFYPDGKNPEDNSTYVSVFIALASDGTDVRALFELTLLD
QSGKGKHKVHSHFDRSLESGPYTLKYRGSMWGYKRFFRRTALEQSDFLKDDCLKINCTVG
VVVSTMDYSRPHSIEVPESDIGFHFGTLLDTQEGVDVIFSVAGEKFHAHKLVLAARSPFF
RSEFFDHELGEEKNGTDTGDEIKEIVIDDMDPVVFKAVLHFIYRDNLVNDDELSASSSDC
SIFDRLSGKLMAAADKYELPRLRLLCESYLCKHISVNSVATTLALADRHHAMELKSVCLK
FAAENLSAVIRTEGFDYLKDNCPSLQSEILRTVAGCEEPCSSGLKSQSVWAQLSDGGDTS
GRRVRPRV*

Other information
Ka divergence:0.0829667KaKs divergence:0.215175
GC content 1 (%):52GC content 2 (%):53GC content divergence:0.01
Length 1 (bp):1287Length 2 (bp):1287Length divergence:0
MFE 1 (kcal):-478.7MFE 2 (kcal):-483.38MFE divergence0.005