Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:GRMZM2G060993-GRMZM2G096412
Species:maize
Duplication type:TD
Function (paralog1):hypothetical protein LOC100279546
Function (paralog2):hypothetical protein LOC100193798

Regulation information
Data set:seedling_Lei_2015
Log2 RF fold difference:0.14956180730877
Log2 mRNA fold difference:-0.39677063630952
Log2 TE fold difference:0.56063049952005
Sequences
Protein sequence

MQAIKKTIVLYPGLFVSHFVPMMQLADVLLEEGYAVAVALIDLTMDQDVTLAAAVDRVAS
AKPSVTIHRLPRIQNPPAITDCGGDGLLWYFKTVKRYNDPLREFLCSLQQQQPARSVVHA
VILDGPSADALDVTKELGIPAYTFYATNASAVAVFLQLPWTHAEGQPSFKELGDTPLSIS
GVPPMPASYLMPPMLDDPASETYKTMMRVSRRNPEPEGILVNTFASLEGRVLRALRDPLF
LPIGDDGCRRMPPVYCVGPLVVGAGDGDGVGVGEAKEKHECLAWLDEQPERSVVFLCFGS
LGAAAHSEEQLKEIAVGLERSGHRFLWVVRAPLPTEGVDPGRLFDPRADFDLCALLPAGF
LERTRARGLVVKLWAPQVNVLNHRATGAFVTHCGWNSVMEAVTAGVPMLCWPMYAEQKMN
SVVMVEEAGIGVDLVGWQQGLVNAEEVERKVKMVMEFKEGEQLRARVTAHRDAAAVAWKD
GGSSRAAFGLFLSDVDNHVHKAKTWSSANGRDGKLGQS*

MEKTVVLYPGLSVSHFVPMMQLADMFLEEGYAVAVALIDLTLDQDAALADAVDRVASAKP
SVAFHRLLRIQNPPTVTDDGEPFLWYFQILKRYNDRLREFLCSLPPRSVHAVIVDALSVD
ALDVTKELGLPAYTFCAANASALAVFLQLPWIRAEGQPSFKELGDAPVNFSGVPPIPASH
LVRQMLDPESEIYTAMMNAMRRGAEDPDGILVNTFASLEARAVGALRDPQLVPPSSGRAR
RTPPVYCVGPLVAGAGAEAKEKHECLAWLDGQPERSVVLLCFGSIGAATHSEEQLREVAV
GLQRSGHRFLWVVRAPLRGDTERLFDPRADTDLDALLPDGFLEATRDRGLVVKHWAPQVE
VLNHRATGAFVTHCGWNSVLEGITAGVPMLCWPMYAEQKMNKLFMVEEAMVGVEMVGWQQ
GLVSAEEVEAKVRLVLEESEEGNQLRTRVAAHRNAATMARRGGGSSRAAFGQFLSDAAKL
ARE*

Other information
Ka divergence:-0.24895KaKs divergence:-0.295487
GC content 1 (%):64GC content 2 (%):65GC content divergence:0.008
Length 1 (bp):1557Length 2 (bp):1452Length divergence:-0.035
MFE 1 (kcal):-709.4MFE 2 (kcal):-668MFE divergence-0.03