Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:GRMZM2G061096-GRMZM2G164821
Species:maize
Duplication type:WGD
Function (paralog1):LOC100282600
Function (paralog2):transmembrane 9 superfamily protein member 1

Regulation information
Data set:seedling-drought_Lei_2015
Log2 RF fold difference:-0.82387338147994
Log2 mRNA fold difference:-0.3823229778664
Log2 TE fold difference:-0.43923149188823
Sequences
Protein sequence

MAASPAAAAALLILFALGAAGGVAADGSDHRYKMYEPVPLYANKVGPFHNPSETYRYFDL
PFCSPEKVKEKSEALGEVLNGDRLVDAPYKLDFRSEVESKAVCSKKLTKEDVVKFRNAVA
KDYYFQMYYDDLPLWGFIGKVEKGGKADPSEWKYYLYRHIIFDILYNNDRVIEINVHTDQ
SALVDLTEDKETNVDFLYSVKWKETPTPFEKRMEKYSSSSNMPHHLEVHWFSIINSCVTV
LLLTGFLATILMRVLKNDFVKYAHDEEAADDQEESGWKYIHGDVFRFPKNKSLFSAALGT
GTQLFALTTFIFLLALVGVFYPYNRGALFTALVVIYALTSGIAGYVATSFYSQLEGTNWV
RNLLLTGCLFCGPLLLTFCFLNTVAIAYSATAALPFGTICVIVLIWTLVTFPLLVLGGIA
GKNSKSEFQAPCRTTKYPREIPPLPWYRRTIPQMAMAGFLPFSAIYIELYYIFASVWGHR
IYTIYSILFIVFIILLIVTAFITVALTYFQLAAEDHEWWWRSFLCGGSTGFFVYGYCLYY
YYARSDMSGFMQTSFFFGYMACICYAFFLMLGMVGFRAALFFVRHIYKSIKCE*

MAALRAPAATLLVLLALAAAGGVAADGSDHRYKIREPVPLYANKVGPFHNPSETYRYFDL
PFCSPDKVKEKSEALGEVLNGDRLVDAPYKLDFRDEVESKAVCSKKLTTEDVVKFRNAVA
KDYYFQMYYDDLPLWGFIGKVEKGGKDDPSEWKYYLYRHIIFDILYNNDRVIEINVHTDQ
SALVDLTEDKETNVEFLYSAKWKETPTPFEKRMEKYSSSSNMPHHLEVHWFSIINSCVTV
LLLTGFLATILMRVLKNDFVKYAHDEEAADDQEESGWKYIHGDVFRFPKNKSLFSAALGT
GTQLFALTTFIFLLALVGVFYPYNRGALFTALVVIYALTSGIAGYIATSFYCQLEGTNWV
RNLLLTGCLFCGPLFLTFCFLNTVAIAYSATAALPFGTICVIVLIWTLVTFPLLVLGGIA
GKNSKSEFQAPCRTTKYPREIPPLPWYRRTIPQMAMAGFLPFSAIYIELYYIFASVWGHR
IYTIYSILFIVFIILLIVTAFITVALTYFQLAAEDHEWWWRSFLCGGSTGFFVYGYCLYY
YYARSDMSGFMQTSFFFGYMACICYAFFLMLGMVGFRASLFFVRHIYKSIKCE*

www.000webhost.com

Other information
Ka divergence:-0.0130473KaKs divergence:-0.25
GC content 1 (%):49GC content 2 (%):48GC content divergence:-0.01
Length 1 (bp):1782Length 2 (bp):1782Length divergence:0
MFE 1 (kcal):-614.82MFE 2 (kcal):-606.12MFE divergence-0.007