Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:GRMZM2G061135-GRMZM2G117198
Species:maize
Duplication type:WGD
Function (paralog1):hypothetical protein LOC100279822
Function (paralog2):hypothetical protein LOC100191838

Regulation information
Data set:seedling_Lei_2015
Log2 RF fold difference:-0.58509474897894
Log2 mRNA fold difference:0.55432120192831
Log2 TE fold difference:-1.227703391444
Sequences
Protein sequence

MAGLDTFLFTSESVNEGHPDKLCDQVSDAVLDACLAEDPDSKVACETCTKTNMVMVFGEI
TTKANVDYEKIVRETCRNIGFVSNDVGLDADHCKVLVNIEQQSPDIAQGVHGHFTKRPEE
IGAGDQGHMFGYATDETPELMPLSHVLATKLGARLTEVRKNGTCPWLRPDGKTQVTVEYR
NEGGAMVPIRVHTVLISTQHDETVTNDEIAADLKEHVIKPVIPEQYLDEKTIFHLNPSGR
FVIGGPHGDAGLTGRKIIIDTYGGWGAHGGGAFSGKDPTKVDRSGAYVARQAAKSIVAAG
LARRAIVQVSYAIGVPEPLSVFVDTYGTGAIPDKEILKIVKENFDFRPGMIIINLDLKKG
GNGRYLKTAAYGHFGRDDPDFTWEVVKPLKAEKPSSA*

MRIVIFALAILCVSNICIVRCRSKKMAAVDTFLFTSESVNEGHPDKLCDQVSDAVLDACL
AEDPDSKVACETCTKTNMVMVFGEITTKANVDYEKIVRETCRNIGFVSNDVGLDADHCKV
LVNIEQQSPDIAQGVHGHFTKRPEEIGAGDQGHMFGYATDETPELMPLSHVLATKLGARL
TEVRKNGTCPWLRPDGKTQVTVEYRNEGGAMVPIRVHTVLISTQHDETVTNDEIAADLKE
HVIKPVIPEQYLDEKTIFHLNPSGRFVIGGPHGDAGLTGRKIIIDTYGGWGAHGGGAFSG
KDPTKVDRSGAYVARQAAKSIVASGLARRAIVQVSYAIGVPEPLSVFVDTYGTGAIPDKE
ILKIVKENFDFRPGMIIINLDLKKGGNGRYLKTAAYGHFGRDDPDFTWEVVKPLKSEKPS
A*

Other information
Ka divergence:-0.577778KaKs divergence:-0.497908
GC content 1 (%):61GC content 2 (%):56GC content divergence:-0.043
Length 1 (bp):1194Length 2 (bp):1266Length divergence:0.029
MFE 1 (kcal):-493.65MFE 2 (kcal):-497.4MFE divergence0.004