Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:GRMZM2G061186-GRMZM2G111247
Species:maize
Duplication type:WGD
Function (paralog1):hypothetical protein LOC100304385
Function (paralog2):hypothetical protein LOC100194293

Regulation information
Data set:seedling_Lei_2015
Log2 RF fold difference:1.1328158870897
Log2 mRNA fold difference:1.3482316797998
Log2 TE fold difference:-0.22348156239032
Sequences
Protein sequence

MGGFEDDEPPSKRARASSVESASLPDCFLFSKSANPLGSTMARPLPSQGKEAMVGSKGVI
KKEEFVRIISKTLYSLGYEKSGAVLEEESGITLHNPMVNLFREQVIDGNWDNAVVTLNKI
GLQDVNIMKSAAFLILEQKFFELLRNDNVMGAMKTLRREITPLGVNRKRVHELSTCMISC
SPQQLFLGFSKLGIDSSSSRFKLLEELQKVLPPTVMVPERRLENLVEQALTVQRDACYFH
NSVDGLSLYIDHHCGKDQLPSRTLQVLHAHHDEVWFVQFSNNGKYLASASNDKSAIIWEV
NEDGELLLRHTLSGHQKSVMMVAWSSDDCQLLTCGQEEAIRRWDVKSGKCLHVYEHPGIG
LRSCAWFRDGKQILSGLADQTFCIWDLDGKEVDCWKGQRSATTSDFAVAKDGNLIISLSR
DNAILLFDRETKHERIIEEGSTITSFSLSEDGDFLLVNLVSEEIHLWNIRNDPVRVNRYN
GHKHSRFVIRSCFGGSEQAFIASGSEDSQVYIWHRATGDLIETLAGHSGTVNCVSWNPVN
PHMLASASDDHTVRIWGAKVSLKRKDVGSSNCNSNGFHHSNGNAHGNGFAHQCNGNSTK*

MGGSEDDEPPSKRARTSSVESASLPDCFSFSKFSNPLGSTMARPLPSQGKEVMVGSKGVI
KKEEFVRIITKTLYSLGYEKSGAVLEEESGIILHNPMVKLFREQVIDGNWDNAVVTMNTI
GLQDENILKSAAFLILEQKFFELLKNDNVMGAMKTLRCEITPLGVNRKRVHELSTCMISC
SSQQLFLGFSKLGIDSSSSRLKLLEELQKVLPPAVMVPERRLENLVEQALTVQRDACYFH
NSVDGLSLYIDHHCGKDQIPSCTLQVLRAHHDEVWFIQFSNNGKYLASASNDKSAIIWEV
DEDGELLLRHTLSGHQKSVMMVAWSPDDCQLLTCGQEETIRRWDVKSGKCLHVYEKSATG
LISCAWFPDGKQLSGLADQNFCIWDLDGKEVDCWKGQGSTGTSDFAVAKDGNLIISMSKQ
NTILLFDRETKQERIIEEGSTITSFCLSEDGDFLLVNLVSEEIHLWNIRNDPVRVNRYNG
HKRTRFVIRSCFGGFEQAFIASGSEDSQVYIWHRATGDLIETLAGHSGTVNCVSWNPANP
HMLASASDDHTVRIWGAKKSSLKRKDVGSSNCNSNGSRSNGNAHNNVFVQKCNGNNTK*

Other information
Ka divergence:0.138769KaKs divergence:0.0932741
GC content 1 (%):42GC content 2 (%):42GC content divergence:0
Length 1 (bp):1800Length 2 (bp):1797Length divergence:-0.001
MFE 1 (kcal):-559MFE 2 (kcal):-551.37MFE divergence-0.007