Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:GRMZM2G061447-GRMZM2G343024
Species:maize
Duplication type:WGD
Function (paralog1):putative Pti1-like kinase
Function (paralog2):pto kinase interactor 1

Regulation information
Data set:seedling_Lei_2015
Log2 RF fold difference:-0.927421032316
Log2 mRNA fold difference:-1.2612465211602
Log2 TE fold difference:0.33685636330151
Sequences
Protein sequence

MSCFACCGDEDTQVPDTRAQYPGHHPARADAYRPSDQPPKGPQPVKMQPIAVPAIPVDEI
REVTKGFGDEALIGEGSFGRVYLGVLRNGRSAAVKKLDSNKQPDQEFLAQVSMVSRLKHE
NVVELLGYCADGTLRVLAYEFATMGSLHDMLHGRKGVKGAQPGPVLSWSQRVKIAVGAAK
GLEYLHEKAQPHIIHRDIKSSNVLLFDDDVAKIADFDLSNQAPDMAARLHSTRVLGTFGY
HAPEYAMTGQLSSKSDVYSFGVVLLELLTGRKPVDHTLPRGQQSLVTWATPRLSEDKVRQ
CVDSRLGGDYPPKAVAKFLELVCRLAIHPEVLTLLVLLSLEQFAAVAALCVQYEADFRPN
MSIVVKALQPLLNAHARATNPGEHAGS*

MSCFACCGDEDTQVPDTRTQYPGHHPARADAYRPADQPPKGSQPVKMQPIAVPAIPVDEL
REVTKGFGDEALIGEGSFGRVYLGVLRNGRSAAVKKLDSNKQPDQEFLAQVSMVSRLKHE
NVVELLGYCADGTLRVLAYEFATMGSLHDMLHGRKGVKGAQPGPVLSWLQRVKIAVGAAK
GLEYLHEKAQPHIMHRDIKSSNVLLFDDDVAKIADFDLSNQAPDMAARLHSTRVLGTFGY
HAPEYAMTGQLSSKSDVYSFGVVLLELLTGRKPVDHTLPRGQQSLVTWATPRLSEDKVRQ
CVDSRLGGDYPPKAVAKFAAVAALCVQYEADFRPNMSIVVKALQPLLNAHARATNP*

Other information
Ka divergence:0.438717KaKs divergence:0.177122
GC content 1 (%):51GC content 2 (%):51GC content divergence:0
Length 1 (bp):1164Length 2 (bp):1071Length divergence:-0.042
MFE 1 (kcal):-408.72MFE 2 (kcal):-388.7MFE divergence-0.025