Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:GRMZM2G061626-GRMZM2G002805
Species:maize
Duplication type:WGD
Function (paralog1):ZFP16-2
Function (paralog2):ZFP16-2

Regulation information
Data set:seedling-drought_Lei_2015
Log2 RF fold difference:0
Log2 mRNA fold difference:0
Log2 TE fold difference:0
Sequences
Protein sequence

MKHPRPTEQDVSLALSLSTDSSTTTSDSAGTPPAKRARARARRRGAVVATSGEGEFVCRT
CSRAFPSFQALGGHRTSHLRAGRHGLDLGVVGARALKQHKQQAANANANGCEGGKQRHEC
NVCGLGFEMGQALGGHMRRHREEEMGAADAWVTLWRTEASRAADPPVLLELFA*

MTHPRPDHEPAGEVSLALALSTDSSGGSAGAPAAKRARRRGAAAATSGEGEFVCRTCSRA
FTSFQALGGHRTSHLRGRHGLELGVGARALSRQQHKHHQQAGDGGGGDREPLAQHECHVC
GLGFEMGQALGGHMRRHREETTTGAADAWVWRADDALQRARGGAADPPVLLELFA*

Other information
Ka divergence:0KaKs divergence:0
GC content 1 (%):74GC content 2 (%):76GC content divergence:0.013
Length 1 (bp):522Length 2 (bp):528Length divergence:0.006
MFE 1 (kcal):-305.1MFE 2 (kcal):-303.6MFE divergence-0.002