Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:GRMZM2G061672-GRMZM2G066981
Species:maize
Duplication type:WGD
Function (paralog1):cofactor required for Sp1 transcriptional activation subunit 9
Function (paralog2):hypothetical protein LOC100274258

Regulation information
Data set:seedling_Lei_2015
Log2 RF fold difference:-2.2620568302654
Log2 mRNA fold difference:-1.9437134195261
Log2 TE fold difference:-0.29307153624062
Sequences
Protein sequence

MAMATSASYPPPPPFYRLYKNFEQDPSSAPEPPPPIDEPFKALGVDYTGDVVIPSLESHN
VRQLYPKGPNIDFKKELRTLNRELQLHILELADILVERPSQYARRVEDITLIFKNLHHLL
NSLRPHQARATLIHMLESQIRHRKEAIEDIKQRREEAQKVLGESLLILDGSQTN*

MAMATSSSYPPPPPFYRLYKNFEQDPSSAPEPPPPIDGPFKALGVDYTGDVVIPSLESHN
VRQLYPKGPNIDFKKELRTLNRELQLHILELADILVERPSQYARRVEDITLIFKNLHHLL
NSLRPHQARATLIHMLESQIQRRKEAIEDIKQRRVEAQKLLAESLHILDASQAN*

Other information
Ka divergence:-0.251087KaKs divergence:-0.227392
GC content 1 (%):44GC content 2 (%):45GC content divergence:0.011
Length 1 (bp):525Length 2 (bp):525Length divergence:0
MFE 1 (kcal):-146.76MFE 2 (kcal):-148.91MFE divergence0.007