Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:GRMZM2G061700-GRMZM2G067563
Species:maize
Duplication type:TD
Function (paralog1):
Function (paralog2):hypothetical protein LOC100275775

Regulation information
Data set:seedling_Lei_2015
Log2 RF fold difference:1.8892222936177
Log2 mRNA fold difference:1.81161725603
Log2 TE fold difference:0.078899876310193
Sequences
Protein sequence

MPDVSPLLPPGKPPATTARFARCASSANDELRSFRACLAWLCVDHSSSPRVAAVGSWAVF
LLLAVAAPAAVRLLGTAPPRPFDGQVQVSLTLAASLAYVCLRALLHRAGGLRRLLHLDSL
RRDSEDVQAGYAAQLARSFRVLACFVLPCALAEAAYKAYWYRAAAAAYGSPWWWAAAACA
VEVASWVYRVALFFMVCVLFRVICYLQILRMVGFAREFGRFADVATVLQHHRRIREQLRK
ISHRYRKFIVCSLVLVSASQFAALLATTRPHAIVNLATAGELALCSVSLVAGLLMCLYSA
AKITHKTQAMTSVAAAWHADATVHAFDNDQENPDPDLPPTAGYLAPANAYRVAAGDESGS
GGDDDDDSRSECSSLDDPKYVPFQANNISFQKRQALVTYLENNRAGITVYGFVVDRAWLH
ALFMIEFSLVMWLLGKTVGIS*

MADVSPLLPPGKPPATTARFARCASSANDELRSFRACLAWLCVDHYSSPRVAAVGSWAVF
LLLAVAAPAAVRLLGTAPPRPFDGQVQVSLTLAASLAYVCLRALLHRAGGLRRLLHLDSL
RRDSEDVQAGYAAQLARSFRVLACFVLPCALAEAAYKAYWYRAAAAAYGSPWWWAAAACA
VEVASWVYRVALFFMVCVLFRVICYLQILRMVGFAREFGRFADVATVLQHHRRIREQLRK
ISHRYRKFIVCSLVLVSASQFAALLATTRPHAIVNLATAGELALCSVSLVAGLLMCLYSA
AKITHKTQAMTSVAAAWHADATVHAFDNDQENPDPDLPPTAGYLAPANAYRVAAGDESGS
GGDDDDDSRSECSSLDDPKYVPFQANNISFQKRQALVTYLENNRAGITVYGFVVDRAWLH
ALFMIEFSLVMWLLGKTVGIS*

Other information
Ka divergence:0.00440529KaKs divergence:0
GC content 1 (%):71GC content 2 (%):71GC content divergence:0
Length 1 (bp):1326Length 2 (bp):1326Length divergence:0
MFE 1 (kcal):-663.9MFE 2 (kcal):-664.4MFE divergence0