Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:GRMZM2G061745-GRMZM2G368908
Species:maize
Duplication type:WGD
Function (paralog1):hypothetical protein LOC100274928
Function (paralog2):hypothetical protein LOC100276453

Regulation information
Data set:seedling_Lei_2015
Log2 RF fold difference:-0.61071307871799
Log2 mRNA fold difference:-0.18521352782469
Log2 TE fold difference:-0.41080527554751
Sequences
Protein sequence

MDVVKAAQLSGRTLERVVVHPLVLLSIVDHYNRVARDTRKRVVGVLLGTSSRGSVDVTNS
YAVPFEEDDKDPRIWFLDHNYHESMFSMFKRINAKEHVVGWYSTGPKLRENDLDVHALFN
SYVPNPVLVIIDVQPKELGIPTKAYYAVEEVKENATQKSQKVFVHVPSEIAAHEVEEIGV
EHLLRDVKDTTISTLATEVTSKLAALKGLDARLREIRSYLDLVIDGKLPLNHEILYHLQD
VFNLLPNLNVNELIKAFAVKTNDMMLVIYLSSLIRSVIALHNLINNKMLNKEHEKAEDSK
PTAIPTAAGS*

MDVVKAAQLSGRTLERVVVHPLVLLSIVDHYNRVARDTRKRVVGVLLGTSSRGSVDVTNS
YAVPFEEDDKDPRIWFLDHNYHESMFSMFKRINAKEHVVGWYSTGPKLRENDLDVHALFN
SYVPNPVLVIIDVQPKELGIPTKAYYAVEEVKENATQKSQKVFVHVPSEIAAHEVEEIGV
EHLLRDVKDTTISTLATEVTSKLAALKGLDARLREIRSYLDLVIEGKLPLNHEILYHLQD
VFNLLPNLNVNELIKAFAVKTNDMMLVIYLSSLIRSVIALHNLINNKMLNKEHEKAEDSK
PAAIPTAAGGGGAK*

Other information
Ka divergence:0.343284KaKs divergence:0.266272
GC content 1 (%):48GC content 2 (%):49GC content divergence:0.01
Length 1 (bp):933Length 2 (bp):945Length divergence:0.006
MFE 1 (kcal):-318.9MFE 2 (kcal):-321.51MFE divergence0.004