Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:GRMZM2G061900-GRMZM2G156476
Species:maize
Duplication type:WGD
Function (paralog1):hypothetical protein LOC100272423
Function (paralog2):hypothetical protein LOC100273222

Regulation information
Data set:seedling_Lei_2015
Log2 RF fold difference:-0.72945767802804
Log2 mRNA fold difference:0.84655095598503
Log2 TE fold difference:-1.538662714221
Sequences
Protein sequence

MAAPPARARADYDYLIKLLLIGDSGVGKSCLLLRFSDGSFTTSFITTIGIDFKIRTVELD
GKRIKLQIWDTAGQERFRTITTAYYRGAMGILLVYDVTDESSFNNIRNWIRNIEQHASDN
VNKILVGNKADMDESKRAVPTSKGQALADEYGIKFFETSAKTNLNVEQVFFSIARDIKQR
LSETDSKPEDRTIKIKAEGEAEAAAAAQNSACCGS*

MAAPPARARADYDYLIKLLLIGDSGVGKSCLLLRFSDGSFTTSFITTIGIDFKIRTVELD
GKRIKLQIWDTAGQERFRTITTAYYRGAMGILLVYDVTDESSFNNIRNWIRNIEQHASDN
VNKILVGNKADMDESKRAVPTSKGQALADEYGIKFFETSAKTNLNVEQVFFSIARDIKQR
LSETDSKPEDRTIKIKAEGEADAAEAQKSACCGS*

Other information
Ka divergence:-0.247026KaKs divergence:-0.16129
GC content 1 (%):48GC content 2 (%):46GC content divergence:-0.021
Length 1 (bp):648Length 2 (bp):645Length divergence:-0.002
MFE 1 (kcal):-201.01MFE 2 (kcal):-182.31MFE divergence-0.049