Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:GRMZM2G061941-GRMZM2G322950
Species:maize
Duplication type:WGD
Function (paralog1):VQ motif family protein
Function (paralog2):

Regulation information
Data set:seedling_Lei_2015
Log2 RF fold difference:1.561657894369
Log2 mRNA fold difference:-1.3054250101159
Log2 TE fold difference:2.6840076273062
Sequences
Protein sequence

MYSFEQQDHTAAARTTTGTATLDTTSYLQPCAGAAAAARSLQLPAHHPGHQALRTAPAVP
PRRGKSAKKHATAAAARHSPSPSSSRRSSTTVVATDVANFRAMVQELTGFPPAAIFRPLP
RRVHAASPFVAVAAGQGCGHGGSEATNSSTAGAGSGSGSGSSPGDAPAVPPVALAAQQQP
QFAPLGVFDGLPDLGSPEFDSWGDLSID*

MYSFDLEQDHTAAAARTTATTTYQPCARGARSLQLSGAHHYHPGEQALRTAAAVRPRRAK
SSSSRKHAPSSSRRSSTTVVATDVSNFRAMVQELTGFFPPPAAVFRPLPRRVHATSPSVA
VAVAAGQGCGWERRGSHGSSEAANSSTAGGGSSPDEGPAVPPPLVVAPQPQFAPLGVFDG
LPDLGSPEFGWWGDLSIDF*

Other information
Ka divergence:0.37049KaKs divergence:0.834053
GC content 1 (%):73GC content 2 (%):72GC content divergence:-0.007
Length 1 (bp):627Length 2 (bp):600Length divergence:-0.022
MFE 1 (kcal):-335.7MFE 2 (kcal):-298.4MFE divergence-0.059