Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:GRMZM2G061990-GRMZM2G700683
Species:maize
Duplication type:WGD
Function (paralog1):
Function (paralog2):

Regulation information
Data set:seedling-drought_Lei_2015
Log2 RF fold difference:0.94173904497324
Log2 mRNA fold difference:1.5316618499626
Log2 TE fold difference:-0.58503764147924
Sequences
Protein sequence

MATSLYTPSQLRPSHSQARRLGSHPRVCSARCPARRRRAAAISVRASTDGDAAVTVRRFP
AAPTKAGGLSGVKKIMILGAGPIVIGQACEFDYSGTQACKALVEEGYEVVLVNSNPATIM
TDPGLAHRTYIGPMTPTLVERIIDAERPDALLPTMGGQTALNLAVSLADSGALDRLGVRL
IGASLPAIRAAEDRQLFKQAMDRIGLQTPPSGIGTTLEECLTIAEDIGEFPLIVRPAFTL
GGTGGGIAYNRAEFEDICRAGLTASHTQQVLVEKSLLGWKEYELEVMRDMADNVVIICSI
ENIDPMGVHTGDSITVAPAQTLTDKEYQRLRDYSVAIIREIGVECGGSNVQFAVNPADGE
VMVIEMNPRVSRSSALASKATGFPIAKMAAKLSVGYTLDQIPNDITKKTPASFEPSIDYV
VTKIPRFAFEKFPGSEPILTTQMKSVGEAMALGRTFQESFQKAVRSLETGFAGWGCGPIK
ELDWDWEQIKYSLRVPNPDRIHAIYAAFKKGMRVEDIHEISFIDKWFLTELRELVDVEQF
LLSRSLDQLSKDDFYQVKRRGFSDKQIAFATSSSESDVRSRRLALGVTPSYKRVDTCAAE
FEANTPYMYSSYEYECESAPTNKKKVLILGGGPNRIGQGIEFDYCCCHASFALREAGYET
IMMNSNPETVSTDYDTSDRLYFEPLTVEDVLNVLDLERPDGIIVQFGGQTPLKLALPIQQ
YIEENKMVSASGTGNVKIWGTSPDSIDAAEDRKRFNAILEELGIEQPKGGIARSESDALA
IASEIGYPVVVRPSYVLGGRAMEIVYNDEKLIKYLATAVQVDPERPVLVDKYLIDAVEID
VDALADTAGNVVIGGIMEHIEQAGIHSGDSACSLPTRTVSAKCLEVIRSWTTKLAKCLNV
CGLMNCQYAISTSGDVFLLEANPRASRTVPFVSKAIGHPLAKYASLVMSGVTLPELGFTE
EVIPKHVSVKEAVLPFEKFQGCDILLGPEMRSTGEVMGIDYEFSGAFAKAQIAAGQKLPL
SGTVFLSLNDLTKRHLAEIGRGFRELGFSIVATSGTAKVLQLEGVPVEPVLKIHEGRPNA
RDMLKNGQIQIMVITSSGDALDSKDGLQLRRLALAYKVPITTTVDGARASIDAIKSLKNK
SIEILALQDYFQTADASEDLQAVARTAP*

MATSLSTPSQLRTSHCHARRYGRLLGLHPRVSCARCPAPRRAAALSVRANAASTDGDAAV
TVRRFPAAPTKAGRLAGVKKIMILGAGPIVIGQACEFDYSGTQACKALAEEGYEVVLVNS
NPATIMTDPGLAHRTYIGPMTPPLVERIIDAERPDALLPTMGGQTALNLAVSLADSGALD
RLGVRLIGASLPAIRAAEDRQLFKQAMDRIGLKTPPSGIGTTLEECLAIAEDIGELPLIV
RPAFTLGGTGGGIAYNKAEFEDICRAGLAASHTQQVLVEKSLLGWKEYELEVMRDMADNV
VIICSIENIDPMGVHTGDSITVAPAQTLTDKEYQRLRDYSVAIIREIGVECGGSNVQFAV
NPADGEVMVIEMNPRVSRSSALASKATGFPIAKMAAKLSVGYTLDQIPNDITKKTPASFE
PSIDYVVTKIPRFAFEKFPGSEPILTTQMKSVGEAMALGRTFQESFQKAVRSLETGFAGW
GCGPIKELDWDWEKIKYSLRVPNPDRIHAIYAAFKKGMRVEDIHEISFIDKWFLTELKGL
VDVEQFLLSKSLDQLSKDDFYQVKKRGFSDKQIAFATSSSESDVRSRRLTLGVTPTYKRV
DTCAAEFEANTPYMYSSYEYECESSPTNRKKVLILGGGPNRIGQGIEFDYCCCHASFALR
EAGYETIMMNSNPETVSTDYDTSDRLYFEPLTVEDVSNVLDLERPDGIIVQFGGQTPLKL
ALPIQQYIEENKMVSASGTGNVKIWGTSPDSIDASEDRKRFNAILEELQIEQPKGGIARS
ESDALAIASEVGYPVVVRPSYVLGGRAMEIVYNDEKLIKYLATAVQVDPERPVLVDKYLI
DAVEIDVDALADTAGNVVIGGIMEHIEQAGIHSGDSACSLPTRTVSAQCLEVIRSWTTKL
AKRLNVCGLMNCQYAISTSGDVFLLEANPRASRTVPFVSKAIGHPLAKYASLIMSGVTLP
ELGFTKEVIPKHVSVKEAVLPFEKFQGCDILLGPEMRSTGEVMGIDYEFSGAFAKAQIAA
GQKLPLSGTVFLSLNDLTKRHLAEIGSGFRELGFSIIATSGTAKVLQLEGVPVEPVLKIH
EGRPNARDMLKNGQIQIMVITSSGDALDSKDGLQLRRLALAYKVPIITTVDGARASIDAI
KSLKDKSIEILALQDYFQTADASADLQAAAQTTP*

Other information
Ka divergence:-0.156526KaKs divergence:-0.00968523
GC content 1 (%):54GC content 2 (%):53GC content divergence:-0.009
Length 1 (bp):3507Length 2 (bp):3525Length divergence:0.003
MFE 1 (kcal):-1344.97MFE 2 (kcal):-1348.67MFE divergence0.001