Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:GRMZM2G062045-GRMZM2G157147
Species:maize
Duplication type:WGD
Function (paralog1):
Function (paralog2):hypothetical protein LOC100216938

Regulation information
Data set:seedling-drought_Lei_2015
Log2 RF fold difference:-1.093892507017
Log2 mRNA fold difference:-1.1301943677443
Log2 TE fold difference:0.13525469044943
Sequences
Protein sequence

MRRVAPAMTAASSAAGGEETAVVEKTLLNGDVYRGGSPHGKGRYVWADGCMYEGNWRRGK
ASGKGRFSWPSGATFEGQFRRGRIDGQGVFVGPDGATYRGAWVADRRHGLGNKTYANGDC
YEGQWRRNLQDGHGRYVWANGNQYIGEWRAGVLSGRGALICANGSRYDGVWENGVPKGSG
VFTWPTGGSWPGSSVDLPAMSATFFAPPGAVAVSRRSSVEGVGDKATPRICIWESEGEAG
DITCDIVDALEASMPMLFKEAAAIAGGATYMRSASGVPRWASAVATTPQSKRPGRTISKR
HKNYELMLQLQLGIMHSVGKSSAVPMRELEQGDFDPRENALSWTEFPPEGSKATLPHSTG
YFCWKDYCPMVFRHLRKLFAVDTGDYMLSICGNDPLRELSSPGKSGSFFYLTQDDQFMIK
TVKKSEVKLLLKMLNSYCKHVDRYKNSLITRFYGVHCVKRHNGQKVRFIVMGNLFCSEYQ
IHRRFDLKGSSYGRTADKFEDEIDETTTLKDLDLNFVFRLQKSWYTDLHEQLRRDCDFLE
SEGIMDYSFLIGIHFCDDISASKMGSSTFTASPKRLIKSESFQGGGTTELCFSDDAFDMV
PDCSRKSLIRLGAHMPGRAEQASRRSGFVFPNQTGEVHDVILFFGIIDILQDYSVKKRLE
HSYKSLQTDPNSISAVEPKLYSRRFQEFIGRIFVEDG*

MRRVAPAMIAAGSAGGEDTAEGAVVEKTLLNGDVYRGGFSAGSPHGKGKYVWADGCMYEG
EWRRGKASGKGRFSWPSGATFEGEFRSGRIEGQGVFVGPDGATYRGAWVADRRHGVGAKS
YANGDYYEGQWRRNFQDGHGRYVWANGNQYVGEWRAGVLSGRGVLIWANGSRYDGVWENG
VPRGTGVFTWPDGSRYVGSWPGTCVDLPAISGTFFAPVGAGAPAAVRKRSSVEGVGEKAT
PRICIWESEGEAGDITCDIVDALEASMLYKEAAAVAGGATYTRKLPQRNTRRAASGVPRW
ASSAATTPESKRPGQTISKGHKNYELMLQLQLGIRHSVGKSSAVPMRALQPGDFDPGEKF
WTRFPPEGSKVTLPHSSGEFRWKDYCPMVFRHLRKLFAVDTADYMLAICGNDALRELSSP
GKSGSFFYLTQDDRFMIKTVKKSEVKLLIRMLNSYYNHFNRYKNSLITRFYGVHCVKPLN
GQKVRFIVMGNLFCSEYQIHRRFDLKGSSYGRTADKFEDEIDETTTLKDLDLNFVFRLQR
SWYTDLHEQLGRDCDFLESEGIMDYSFLVGVHFCDDISASKMGSSTFTASPKLLTKSESF
QGGGTPELCFSDDDFDMVPDCHRKPLIRLGAHMPARAEQASRRSEFDPLLLTGGGFLFPN
QTGEVHDVILFFGIIDILQDYSLRKRAEHAYKSLQTDPNSISAVDPKLYSKRFQDFIGRI
FVEDG*

Other information
Ka divergence:-0.763583KaKs divergence:-0.617175
GC content 1 (%):56GC content 2 (%):56GC content divergence:0
Length 1 (bp):2094Length 2 (bp):2178Length divergence:0.02
MFE 1 (kcal):-835.6MFE 2 (kcal):-897.39MFE divergence0.036