Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:GRMZM2G062076-GRMZM2G154278
Species:maize
Duplication type:WGD
Function (paralog1):LOC100282711
Function (paralog2):hypothetical protein LOC100192769

Regulation information
Data set:seedling_Lei_2015
Log2 RF fold difference:-0.55067037405318
Log2 mRNA fold difference:-1.0492392839294
Log2 TE fold difference:0.50721277074158
Sequences
Protein sequence

MTTAARPTWAPAKGGNEQGGTRIFGPSQKFSSRDLAAHTSLKPRKDGQQTQEELQKRNLR
EELEERERKHYSSKDKSYAEERDRRKSSSHLLLEGSKRETEDKIVPREIDADDSDVEPKS
DDESDEDDDDDDTEALMAELERIKKERAEEKLRKERQQAEEEAKMKEAELMRGNPLININ
NAGSFSVKRRWDDDVVFKNQARGETKTPKRFINDTIRSDFHRKFLQRYMK*

MTTAARPTWAPAKGGNEQGGTRIFGPSQKYSSRDLAAHTSLKLRKDGQQTQEELQKRNLR
EELEERERKHYSSKDKSYAEERDRRKSSSQLLLEGSKREAEDKIVPREIDADDSDVEPKS
DDESDEDGDDDDTEALMAELERIKKERAEEKLRKERQQAEEEAKMKEAELMRGNPLININ
NPGSFSVKRRWDDDVVFKNQARGETKTPKRFINDTIRSDFHRKFLHRYMK*

Other information
Ka divergence:-0.140868KaKs divergence:-0.371274
GC content 1 (%):52GC content 2 (%):52GC content divergence:0
Length 1 (bp):693Length 2 (bp):693Length divergence:0
MFE 1 (kcal):-222.2MFE 2 (kcal):-226.01MFE divergence0.009